(data stored in ACNUC7421 zone)

EMBL: CP001389.PE309

CP001389.PE309       Location/Qualifiers
FT   CDS_pept        353966..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ8"
FT                   /protein_id="ACP24113.1"
FT                   /translation="MRKVYSMRSDAPVMQQHFLNKEESFMYDREANFPMEDTRNDARIE
FT                   FTEKGMQNLSSRRCEIIKLSKSSAVIGIVTKFQLPQNFYLDIPSARIPLIGCLLKRVHA
FT                   NNLIEARFLRLLSDRDLNRIFVYSTHPNHRNRTLDIYR"
     atgcgaaagg tctattcgat gcgcagcgat gcccctgtga tgcaacagca ctttctcaac        60
     aaggaagagt cgttcatgta tgatcgggag gcgaacttcc cgatggagga cacgcgcaac       120
     gacgcgcgga tcgaatttac cgagaaggga atgcagaacc tttcgtcgcg ccgctgcgag       180
     atcatcaagc tgtcgaagag cagcgccgtc atcggcatcg tcacgaagtt ccagctgccg       240
     cagaatttct atctcgacat cccgagtgcc cgcattcccc tgatcggctg cctgctgaag       300
     cgggtccacg ccaacaacct gatagaggcg cgcttcctgc ggctcctaag cgaccgcgac       360
     ctgaaccgga tcttcgtcta cagtacccat ccgaaccatc gcaaccgcac gctcgacatc       420
     tatcgctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page