(data stored in ACNUC7421 zone)

EMBL: CP001389.PE310

CP001389.PE310       Location/Qualifiers
FT   CDS_pept        354428..354805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03160"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutathione-dependent
FT                   formaldehyde-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24114"
FT                   /db_xref="GOA:C3MGJ9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ9"
FT                   /protein_id="ACP24114.1"
FT                   /translation="MRAAMQRPYRLSCHCGEIAIEVDAELSRLVECNCSTCRRSGFLHW
FT                   KVDAAAVRLLTEKRRMSTYIWRGIGEGHHFCPTCGTAILRSGYPGDRVSLNARCIEGVD
FT                   VFTLEVDRYDGRNDMPPGPLP"
     atgagagcgg ccatgcaacg accctatcgc ctttcctgtc actgcggcga aatcgccatc        60
     gaggtcgatg ctgaactttc gcggctcgtc gagtgcaact gttcgacctg ccggcgctcg       120
     ggcttcttgc attggaaggt ggatgccgcc gccgtcaggc tcctcacgga aaagcgccgt       180
     atgtcgacct atatctggcg cggcatcggc gagggccatc atttctgccc gacttgcggc       240
     accgcgatcc tgcgcagcgg ctatcccggc gaccgcgttt cgctgaatgc ccggtgcatc       300
     gagggcgtcg atgtgttcac cctcgaggtc gatcgctatg acggccggaa tgacatgcct       360
     cccggaccgc tgccataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page