(data stored in ACNUC7421 zone)

EMBL: CP001389.PE316

CP001389.PE316       Location/Qualifiers
FT   CDS_pept        362087..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03220"
FT                   /product="predicted HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24120"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK5"
FT                   /protein_id="ACP24120.1"
FT                   /translation="MIETQDVVIIGAGAAGMMCAIEAGKRGRRVVVIDHARAPGEKIRI
FT                   SGGGRCNFTNIHAGPKNFLSDNPHFCKSALARYRPQDFVSLVERHGIAWHEKTLGQLFC
FT                   DHSAKDIIRMLLAEMKEVGAMLRLETTISAVERTASGFRVATSAGTVDTASLVVASGGK
FT                   SIPKMGATGLAYRIAEQFGLPVVETRPALVPFTLDPAQLEKLGGLAGVAADAEVRFGKI
FT                   AFREAVLVTHRGLSGPAILQISSYWREGAEIVLRLMPDIDIASILKGMRRTGGRQAAQT
FT                   ALADILPRRLAQFFAEEAKLAGRLLADLSDKAIDALSASIQAWTLKPAGTEGYRTAEVT
FT                   LGGVDTRALDSRTMRATNIPGLYFIGECVDVTGWLGGYNFQWAWASGFAAGQDV"
     gtgatcgaga cacaggatgt ggtgatcatc ggggcgggcg ccgccggcat gatgtgcgca        60
     atcgaggcgg gaaagcgcgg ccgccgcgtc gtcgtcatcg accatgccag ggcacccggc       120
     gagaagatcc gcatttcagg cggcggccgc tgcaatttca ccaatattca tgccggtccg       180
     aagaacttcc tttccgacaa tccgcatttc tgcaaatcgg cgcttgcccg ctatcgcccg       240
     caggatttcg tatcgctcgt cgagcggcac ggcatcgcct ggcatgagaa gacgctgggg       300
     cagcttttct gcgaccattc ggccaaggac atcatccgca tgctgcttgc ggagatgaag       360
     gaggtaggcg cgatgctgcg gctcgagacg acgatctcgg ccgtggaacg gaccgcctcg       420
     ggtttccgtg tggcgaccag cgccggaacg gtcgataccg cgtcgcttgt ggttgcgagc       480
     ggcggcaaat ccatcccgaa gatgggcgcg acggggcttg cctatcggat tgccgagcag       540
     ttcggcctgc cggtcgtcga gacgcggcca gcactggtgc catttacgct cgatccggcc       600
     caactcgaaa agctcggcgg ccttgccggt gtggcggccg acgccgaagt ccgcttcggc       660
     aaaattgcct tccgcgaggc ggtgctcgtc acccatcgcg gtttgagcgg gccggcgatc       720
     ctgcagatct cctcctattg gcgcgagggc gcggagatcg tcctcagatt gatgcccgac       780
     atcgacattg cctcgatcct caagggcatg cgccgcacgg gcggccgcca ggcggcgcag       840
     accgcccttg ccgacatcct gccgcggcgg ctcgcgcaat tcttcgccga ggaggcaaag       900
     cttgccgggc gcctgcttgc cgatctctcc gacaaggcga tcgatgcact gtcggcttcc       960
     attcaggcct ggaccttgaa gccggccgga accgagggct accggaccgc cgaggtgacg      1020
     cttggcgggg tcgacacgcg cgccctcgac tcacgcacca tgcgagcgac gaacattccc      1080
     ggcctctatt tcatcggcga atgcgtcgac gtgaccggat ggctgggcgg ctataacttt      1140
     caatgggcct gggcttccgg cttcgccgcc ggtcaagacg tgtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page