(data stored in ACNUC7421 zone)

EMBL: CP001389.PE317

CP001389.PE317       Location/Qualifiers
FT   CDS_pept        363980..366505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03230"
FT                   /product="predicted chemoreceptor y4fA"
FT                   /note="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24121"
FT                   /db_xref="GOA:C3MGK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK6"
FT                   /protein_id="ACP24121.1"
FT                   /translation="MLIDRILARFKIQTKVLFFILPFVVSITAVGITGLYASGLLQGRM
FT                   EISNSVLQTLSGFKDVYAGMNQFLHETTEESRNAVLDTIAAQEQVLADTAAQVAGASGE
FT                   TELDAAIVATNDIEARIDGLWTLHEGEQKLRAATKANLEKLAAEQVKISDETNRLQYAV
FT                   RKDENAAKTMLRNAEKLMRASRFYTEFATEVSKAITVEEKVKVAQELFPRISRTQRDIF
FT                   TLLPKGEKSLAETVNSAAGGIGALIKAPAAPETLGGLAKFVDRFRNASFRLEAASVGKM
FT                   REATQIFAELDSKIAATESVLTATRRLSVSITEIQIATAAFLGNTTEENRQKLLDKFLA
FT                   VQANLTTLRGIAKDLSFFDATADVVVPIIDAMKKDGVSLVEITDKRTAEFNAAGASINE
FT                   IWNDLTGFAEQQKVAAGTEREEANQISVAATVAGVVIALLAGIALTLTLKRPIGQITAA
FT                   MRRLADGMLDTAIDGDARRDEIGDMARALGVFKENALSKVRIEAESAEERARSEAERNR
FT                   NDADKRELDRQIDVAVSELAAGLGRLAQGDLSQQIEVPFHGRLEQLRQDFNGSLIRLQD
FT                   TLAQIRGNAQAIQQGGANMHQSADALSRRTEAQAASLEQTAAAVDQITATVRSSAERAH
FT                   EANQSVSETKRSADSSATVVANAIAAMGRIEDASRQIEQIIEVIDDIAFQTNLLALNAG
FT                   IEAARAGEAGKGFAVVAQEVRELAQRSAEAAREIKGLINKSTDEVSSGSLLVKETGAVL
FT                   ASISAQIVTVSQHVDMIATASRDQATALHEVNGSVNQMDQMTQQNASMVEEATATSRAL
FT                   ATQADTLMMLVEQFRLEPENGAGQVYRAA"
     atgctcattg acaggattct tgcccgcttc aagatccaga cgaaggttct gttcttcatc        60
     ctgccgttcg tcgtcagcat cacggcggtc ggcattaccg gcctctatgc ctcgggcctg       120
     ctgcagggcc gcatggagat ctccaacagc gtgctgcaga cgctgagcgg cttcaaggat       180
     gtctatgcgg ggatgaatca gttcctgcac gagaccaccg aggagagccg caacgcggtt       240
     ctggacacga tcgccgcgca ggaacaggtc ctggctgaca cggccgcgca ggtcgcaggc       300
     gcaagcggcg aaacggaact ggacgccgcg atcgtggcca ccaacgacat cgaggcgcgt       360
     atcgacggac tctggacgct gcacgaaggg gaacagaagc tgcgcgcggc gacgaaggcc       420
     aatctcgaga agttggccgc ggagcaggtg aagatcagtg atgagacgaa ccggctgcaa       480
     tacgccgtcc gcaaggacga gaacgcggcg aagacgatgc tgcgcaatgc cgaaaagctc       540
     atgcgtgcca gccgtttcta cacggaattc gccacggaag tcagcaaggc catcactgtc       600
     gaggaaaagg tgaaggtcgc gcaggagctc ttcccgcgga tcagccgcac gcagcgcgac       660
     atcttcaccc tcctgcccaa gggcgaaaag tccctggccg agacggtcaa ttcggccgcg       720
     ggggggatcg gcgcgctgat caaggcgccg gcagccccgg aaacccttgg cggccttgcg       780
     aaattcgtcg atcgattccg caatgccagc ttccgactgg aggctgcctc ggtcggaaag       840
     atgcgcgagg cgacgcagat cttcgccgag ctcgacagca agattgccgc gacggagtcc       900
     gttctgaccg ccacgcgccg gctgtccgtc tcgatcaccg agattcagat cgccaccgca       960
     gccttcctcg gcaacacgac agaggagaat cgccagaagc ttctcgacaa gttcctggcc      1020
     gtccaggcca acctcacgac cctgcgtggt atagcgaagg acctgagctt cttcgacgca      1080
     acggcggacg tggtcgtgcc gatcatcgac gcgatgaaga aggatggcgt ttctctggtc      1140
     gagatcaccg acaagcggac ggcggaattc aatgccgccg gcgcgtcgat caacgagatc      1200
     tggaacgacc tcaccggatt tgccgagcag cagaaggtcg ccgccggcac ggagcgcgag      1260
     gaagccaacc agatctccgt cgccgccacg gtggccggcg tggtgatcgc gctgctcgcc      1320
     ggcatcgcgc tgacgctgac gctgaaacgg ccgatcggac agatcaccgc ggccatgcgt      1380
     cgcctcgccg acggcatgct cgacacggcg atcgatggcg atgcgcggcg cgacgagatc      1440
     ggcgacatgg cgcgcgcctt gggcgtcttc aaggagaatg ccctttcgaa ggtgcgcatc      1500
     gaggccgaga gtgccgaaga gcgcgcccgt tccgaagccg agcgcaaccg caacgacgcg      1560
     gacaagcgcg agctcgaccg gcagatcgat gtcgccgtca gcgaactggc ggccgggctc      1620
     gggaggcttg cccagggcga tctctcccag cagatcgagg tgcctttcca cgggcgcctg      1680
     gagcagttgc ggcaggactt caacggctcg ctcatccgcc tgcaggacac gctggcgcag      1740
     atccgcggca atgcccaggc gattcagcag ggcggggcca acatgcatca atccgccgat      1800
     gcgctgtcgc ggcgaactga ggcgcaggcc gcttcgctcg aacagactgc agccgccgtc      1860
     gaccagatca ccgcgacggt gcgctcctcg gcggagcgcg cccacgaggc gaaccagtcg      1920
     gtttccgaaa ccaagcgaag cgccgacagc tcggcgaccg tggtcgccaa tgccatcgcc      1980
     gccatgggcc gcatcgagga tgcctcgcgc cagatcgaac agatcatcga ggtcatcgac      2040
     gacatcgcct tccagaccaa cctgctggcc ttgaacgccg gcatcgaggc ggcccgcgcc      2100
     ggcgaggcgg gcaagggctt tgcggtcgtc gcccaggagg ttcgcgaact ggcgcagcgc      2160
     tcggccgagg cggcgcggga aatcaagggg ctcatcaaca agtcgaccga cgaggtcagc      2220
     tccggttcgc tgctcgtcaa ggaaaccggc gccgtgctcg cctcgatcag cgcgcagatc      2280
     gtcaccgtca gccagcatgt cgacatgatc gccaccgcaa gccgcgacca ggcgactgcg      2340
     ctgcatgagg tcaacggctc cgtcaaccag atggaccaga tgacccagca gaacgcctcg      2400
     atggtcgagg aagcgacggc caccagccgc gccctggcaa cccaggccga tacgctgatg      2460
     atgctggtcg agcagttccg cctggaaccg gagaacggtg ccggtcaggt ttaccgcgcc      2520
     gcgtaa                                                                 2526
//

If you have problems or comments...

PBIL Back to PBIL home page