(data stored in ACNUC7421 zone)

EMBL: CP001389.PE320

CP001389.PE320       Location/Qualifiers
FT   CDS_pept        complement(368304..368525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03260"
FT                   /product="hypothetical protein"
FT                   /note="with partial similarity to isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24124"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK9"
FT                   /protein_id="ACP24124.1"
FT                   /translation="MWLVYAAQCKNCHMDLRASAGQGGSRGAYRFDEERSMTDFYKLAV
FT                   PAGSTGDQSSTTAMREATAHDQFGPATE"
     atgtggcttg tttatgcagc gcaatgtaaa aactgtcata tggatttacg agccagtgct        60
     ggccaaggcg gaagccgagg cgcttaccgt ttcgacgagg agagatctat gactgatttt       120
     tacaaactcg ccgtgcccgc cggctccacc ggggaccagt cgtcgacgac agcaatgaga       180
     gaagcgaccg cgcacgatca gttcggcccg gccacagaat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page