(data stored in ACNUC7421 zone)

EMBL: CP001389.PE322

CP001389.PE322       Location/Qualifiers
FT   CDS_pept        370353..371447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03280"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24126"
FT                   /db_xref="GOA:C3MGL1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL1"
FT                   /protein_id="ACP24126.1"
FT                   /translation="MSKFIVATLAAAMLAGSATLASAQERVVNVYNWSDYIDESILEEF
FT                   TKETGIKVVYDVFDSNEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKLPN
FT                   LSNMWDLILERTAKYDPGNEYAVDYMWGTTGIGYNVDKMKEILGTDAKPNWDVIFNPEI
FT                   AAKFKDCGIHLLDSPTDIIPSALAYLGLNPDSHDPADLEKAADVLLKVRPYIRKFHSSE
FT                   YINALANGDICLAVGFSGDIFQARDRAAEAKAGVTVDYSIPAQGAQMWFDMLAMPADAP
FT                   HVAEAHEFINFMMKPEVIAKASNYVFYANGNKASQQFLDREVLEDTAIYPTDDVMQKLF
FT                   TVTPFEPKEQRVLTRLWTKIVTGQ"
     atgtccaaat tcatcgtcgc aaccttggcg gccgcaatgc tggcgggatc ggccacgctc        60
     gcttccgcac aggagcgggt cgtcaacgtc tataattggt cggattacat cgatgaaagc       120
     attctcgagg agttcaccaa ggagaccggc atcaaggtcg tctatgacgt cttcgactca       180
     aacgaaatcc tcgaaaccaa actgcttgcc ggcggctccg gctacgatgt cgtggtgccg       240
     accgcatatt tcctgcagcg ccagatcgcc gcaggcgtat tccagaagct cgacaaatcg       300
     aaactgccga acctctccaa catgtgggat cttatcctgg agcgtacggc caagtacgat       360
     ccgggcaacg aatatgccgt cgactatatg tggggcacca ccggcatcgg ctacaatgtc       420
     gacaagatga aggaaatcct cggcacagac gcgaagccca actgggatgt catcttcaat       480
     cccgagatcg cggcgaagtt caaggattgc ggcatccatc tgctcgattc gccgaccgac       540
     atcatacctt cagcgctggc ctatcttggc ctcaacccgg atagtcacga tccggcggac       600
     ctcgaaaagg cagccgacgt gctcttgaag gtccggccct atatccgcaa gttccactct       660
     tcggaataca tcaatgccct ggcaaacggc gacatctgcc tggccgtcgg attttccggc       720
     gatatcttcc aggcgcgcga ccgcgccgcc gaggcgaagg ccggcgtgac cgtcgactat       780
     tcgatccccg cgcaaggggc gcagatgtgg ttcgacatgc tggcgatgcc ggccgacgcg       840
     ccgcatgtcg ccgaggcgca tgaattcatc aacttcatga tgaagccgga ggtcatcgcc       900
     aaggcgtcga actacgtgtt ctacgccaat ggcaacaagg cctcgcaaca attcctcgac       960
     agggaagtgc tcgaagatac ggccatctat ccgacggacg acgtgatgca gaaactcttc      1020
     actgtcacgc cgttcgaacc caaggagcag agggtgctga caaggctgtg gacgaagatc      1080
     gtcaccggtc agtaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page