(data stored in ACNUC7421 zone)

EMBL: CP001389.PE323

CP001389.PE323       Location/Qualifiers
FT   CDS_pept        371575..372720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03290"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24127"
FT                   /db_xref="GOA:C3MGL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL2"
FT                   /protein_id="ACP24127.1"
FT                   /translation="MMKSLGSIRRSFAPWADPASKPFISVKNVTKKFGDFIAVDDLSLN
FT                   IYTREFFALLGASGCGKSTLLRMLAGFEQPTSGEIILDGQNLAGIPPYRRPVNMMFQSY
FT                   ALFPHMTVENNIAFGLKQDGMPKPEIAERVAQMLKLVKLEKFAQRKPHQLSGGQRQRVA
FT                   LARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQDLGLTFVIVTHDQEEAMTMAD
FT                   RIAVMSHGKVVQVATPAEIYEAPNSRFVADFIGDVNLFDGTVTAAEGALVRIETTGGIP
FT                   LRMASVENLASGAKAAVAIRPEKIRISRQPPAHAPINTAEGEIWDIGYLGDMTVFHVRL
FT                   KDGKVVKASSLNAVRAVEDPLGYDQQIWISFGEDAGVVLKD"
     atgatgaagt ctctcggtag tatccggcgt tctttcgcac catgggcgga ccccgcctcc        60
     aagcccttca tttccgtcaa gaacgtcaca aagaagttcg gcgacttcat cgccgtcgac       120
     gatctttcgc tgaacatcta cacgcgcgag ttcttcgcgc tgctcggcgc ttccggttgc       180
     ggcaagtcga ccctgttgcg catgctcgcc ggcttcgagc agccgacctc cggcgaaatc       240
     atcctcgatg gccagaacct cgccggcatc ccgccctatc ggcggcccgt caacatgatg       300
     ttccagtcct acgcgctgtt cccgcacatg acggtcgaga acaacatcgc tttcggactg       360
     aagcaggacg gcatgccgaa gcccgagatc gccgagcggg tggcgcagat gctgaagctc       420
     gtcaagctcg agaaattcgc ccagcgcaag ccgcatcagc tgtccggcgg ccagcggcag       480
     cgggtggcgc tcgcccgatc gctggccaag cggcccaagg tgctgctgct cgacgagccg       540
     ctcggcgcgc tcgacaagaa gctgcgcgag gaaacccagt tcgaactgat ggatctgcag       600
     caggacctcg gcctcacctt cgtcatcgtc acccatgacc aggaagaggc gatgaccatg       660
     gccgaccgca ttgccgtcat gagtcacggc aaggtcgtcc aggtggcgac gccggccgaa       720
     atctacgagg cgccgaattc gcgtttcgtt gccgacttca tcggcgacgt gaacctgttc       780
     gatggaacgg tgaccgcggc ggaaggggcc ttagtccgga tcgagacgac cggtggcatt       840
     ccgctccgca tggcgtcggt ggagaatctc gcgagcggtg caaaggctgc cgtcgccatt       900
     cgtccggaga agatcaggat cagccgccag ccacctgccc acgcaccgat caatacggcc       960
     gagggcgaga tctgggatat cggctatctc ggcgacatga ccgtcttcca tgtccgcctc      1020
     aaggacggca aggtcgtcaa ggcgtcgtcg ctcaatgccg tgcgcgccgt cgaggatccg      1080
     cttggttacg accagcagat ctggatctcg ttcggcgaag atgcgggcgt ggtgttgaag      1140
     gattga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page