(data stored in ACNUC7421 zone)

EMBL: CP001389.PE326

CP001389.PE326       Location/Qualifiers
FT   CDS_pept        complement(374737..376662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03320"
FT                   /product="AsmA protein family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24130"
FT                   /db_xref="GOA:C3MGL5"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL5"
FT                   /protein_id="ACP24130.1"
FT                   /translation="MAAPQPRGRHFHVSCICPPQGLSKRFHRGDADPTEMTRPIRKISR
FT                   ILRLRLRRRHFVWSAAVGVLLAMGYNAALPLLVSTTGVRATMERTLDSWSGGKSRINGE
FT                   PEVRFWPKLLLTLPSATIESTGPDPRPLAEIGRITASFSPLSALLGDPTLEDISLVDPV
FT                   ITIERRADGTTNWQTPHWLAPPEAPASGRETAFGDIAIVNGRLRVLDRTAGGNDVDIAG
FT                   ISGTIKWPSFAERLSAQLSARLRDEEIAWAIVCEEPLALFARRNASLKTSITSAPVTFS
FT                   FEGVGNLSSVPFASGHLQMSATSLATLVQWYQGTSTETLPSGGLSIDTRVTTGEKTLKL
FT                   DDLAFTMGGASATGVLDIALQDGKAPSVEGTLAFDRIDLNGVPVAALTPFGRDDRLWRL
FT                   AETFVGAWHTDIRLSSQEVLAGPLHLTEVAAGVLIDGKRASLDIGDSNYANGSLSGRVV
FT                   LSDQGLEHGGRLQARLKDANFAAVLASFGLAGPIPAGRGILNIDIGTERAVWAAGSGDF
FT                   SGNLSFSLANGSIAGFDAPAFADLVRKGEFFSLSQANEASFDFQSATVKASFANGTARL
FT                   DRADFVGPSGQLSVAGVIPYRNGSLALAGTLKTEAPTGNQPVLFFVGGSWPNAVISPLS
FT                   VLVAPK"
     atggcagcgc cgcagccgcg tgggcgacat ttccatgtca gttgcatttg ccctcctcag        60
     ggcctatcca aacggtttca ccgaggcgat gccgacccga ccgaaatgac cagacctatc       120
     cggaaaatat cgcgcatcct gaggctgcgt ctgcggcgcc gccacttcgt ctggtctgcc       180
     gcagtcgggg tccttcttgc catgggctac aatgccgcgc tgcccctgct cgtttcgaca       240
     accggcgtgc gcgccacgat ggagcggacg ctcgacagtt ggtcgggggg caagagcagg       300
     atcaatggtg aaccggaggt ccgattctgg ccgaagctgc tgttaacctt gccttcggcg       360
     acgatcgaat cgaccggccc cgatccccgg ccgcttgccg aaattggccg cattaccgca       420
     tcgttcagcc cgctttcggc ccttctcggc gatccaacgc tcgaggacat cagccttgtc       480
     gatcccgtca tcacgatcga gcgccgggcg gacggcacga ccaattggca aacgccgcat       540
     tggctcgcac cgcccgaggc tcccgcttcg ggtcgcgaaa ccgccttcgg agatatcgcc       600
     atcgtcaatg gccggctgcg cgtgctcgac cgcacggccg gcggcaacga cgtcgacatt       660
     gccggaattt ccggcacgat caaatggccc tccttcgccg agcgattgag cgcgcaactg       720
     tcggcgcggc tgcgcgacga ggagattgcc tgggcgatcg tctgcgagga gccactcgct       780
     cttttcgcga gacggaacgc ctccctcaag acctcgatca catcggcgcc cgtgaccttc       840
     tctttcgagg gtgtcggcaa tctttcatcc gtacccttcg cgtcgggtca cctgcagatg       900
     tccgcgacct cgctcgcaac gctcgttcag tggtaccagg gcacgtcgac tgagacgctg       960
     ccttccggcg ggcttagcat cgacaccaga gtgacgacgg gcgaaaagac gctcaagctg      1020
     gacgatctgg cgttcacgat gggcggcgcc agcgccaccg gcgtgctgga tatcgccttg      1080
     caggacggca aggcgccgag cgtcgaggga acgcttgcct tcgatcgcat cgacctcaac      1140
     ggcgttcctg tcgcggcgct cacgccgttc ggcagggacg accgtttgtg gcgtctggcg      1200
     gagacctttg tcggcgcatg gcacacggac attcggcttt cctctcagga ggtcctcgcc      1260
     ggtcccttgc acctcacgga ggtggccgca ggggtgttga tcgatgggaa gcgcgcgtcg      1320
     ctcgacatcg gcgacagcaa ttacgccaat ggcagcctga gcggccgcgt cgtgctctcg      1380
     gatcaagggc tcgaacacgg cggccggctg caggcgcgcc tcaaggacgc caatttcgcc      1440
     gcggtgctcg ccagcttcgg cctcgccggc ccgattccgg ccggccgcgg aattctcaac      1500
     atcgacatcg gaaccgagcg cgccgtctgg gcagccggtt ctggagactt ttcgggcaat      1560
     ctcagctttt cgctggcgaa tggcagcatc gccggcttcg atgcccccgc ctttgccgat      1620
     ctcgttcgca agggcgagtt cttttcgctg tcgcaagcga acgaggcgag cttcgacttc      1680
     cagtccgcga ccgtaaaggc aagctttgcc aacggcacgg cgcgactcga ccgcgccgac      1740
     ttcgtcggcc cttccggcca gttatcggtt gccggcgtca tcccgtatcg caacggcagc      1800
     ctggcacttg ccgggacgct caaaaccgag gcacccaccg gtaaccaacc ggttctcttc      1860
     tttgttggcg gctcgtggcc gaatgcggtc atctcgccgc tctccgtgct cgtcgctccg      1920
     aaatag                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page