(data stored in ACNUC7421 zone)

EMBL: CP001389.PE329

CP001389.PE329       Location/Qualifiers
FT   CDS_pept        complement(380709..384062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03350"
FT                   /product="predicted sensor histidine kinase protein with
FT                   ATP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24133"
FT                   /db_xref="GOA:C3MGL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL8"
FT                   /protein_id="ACP24133.1"
FT                   /translation="MPARQYPFIDIAVHARVREHFARGDAAVLFSKDLARVLWANDQGA
FT                   RLFGVASVYDFIDGALSATDLSLRQLRAAAEQLAAVGDRRQLLIRIAAGFRRLPLNATV
FT                   EMIRIRPGEEAVLFTAPHNGKALSAEERAAAMIAGLDGPDTHMAVLDDDGEIVARSPGF
FT                   EHLGLSGDIRRTLVSAVAREKDRLIKRLVATEKGQLPAAIGKISDHPALHLLFAVETTL
FT                   DTPDAEEAAAKDEPDAIAAAAAEVGTGLPSPTTLDEPAETPLREDTSEAEATTDPAATD
FT                   EPTDAPSLGEEHGELALRSGDEAADLAPSAEAAEPAPEVATSDADSAAAAASGFTFTPG
FT                   SRAVRFVWKIDAEGCFSEISEEFAAAVGPKSADVVGLTFSELAARYDLDPDNKVNALLH
FT                   RRDTWSGKTILWPIEGTSLKVPVDLAALPTYSRSREFDGFRGFGIVRIADAVEDEKASG
FT                   LSLGHIDTPRNEGMPAEAPSDDAPREPASLASDGTDTPRSEAEPPSAEDPFAGERPALR
FT                   IVDIPARPPSDKVIDLDEHRPGSSGTLTRGEQAAFREIARQLGAQFSETTPPAAADEDG
FT                   KRPVDAASQAEAAGDMESLSSEDATAARQEETMPGAGDEAPPAPRGGVGMSSEILDRLP
FT                   VALLIHHGDELLHANPEFLRLTGYRKLEAFQQAGGLEALFAYGAESGEHEPDGTMTLVR
FT                   ANGPLAPVSAHLHSIQWEGRSALMLALAPAAARAADMPSAGADASAGGEARLRMEIDEL
FT                   RSILETATDGVVVLGQDGDIRTMNGSASALFNYDEDEMRGKPFAALFAHESQKAVIDYL
FT                   QGLSGHGVASVLNDGREAIGREAGGGFLPLFMTIGRLSSSNGYCAVIRDITQWKRTEEE
FT                   LRNAKRSAETANAHKTEFLARVSHEIRTPLNAIIGFSDMMASEHFGPIGNPRYIEYAGD
FT                   IGRSGRHVLDIVNDLLDISKIEAGEMELDFSAVDLNEAVSEAVSLVQPQANSQRVIIRT
FT                   SLSGSVPEVVADGRSIKQIALNILANAIRFTPSGGQIVVSTSYETNGSVILRIRDTGIG
FT                   MTRNELDQAMKPFRQVTTGGRKRGEGTGLGLPLTKAMAEANRAQFGISSAPNEGTLVEI
FT                   SFPSQRVLAN"
     atgcccgcga gacagtatcc tttcatcgac attgccgtgc atgcacgggt gcgggagcac        60
     tttgcccggg gggatgccgc ggttctcttt tcgaaagatc tggcgcgcgt cctgtgggca       120
     aacgatcaag gcgccagact gttcggcgtc gcatcggtct acgatttcat cgacggcgcc       180
     ctgagcgcca ccgatctctc cctgcgccag ttgcgtgctg ccgcagagca gcttgccgcc       240
     gtcggcgacc gtcgccaatt gttgatccgc atagcggccg gctttcgcag gctgccgctc       300
     aacgcgaccg tggagatgat ccgcatccgg cctggcgagg aggccgttct cttcaccgct       360
     ccgcacaacg gcaaggcgct ttcggcggaa gaacgcgccg ccgcaatgat cgccgggttg       420
     gacggaccgg acacccacat ggccgtcctc gacgacgatg gcgagatcgt cgcccgatcg       480
     cccggattcg agcatttggg tttgtcgggc gacatccggc ggacgctcgt ctcggcggtg       540
     gcgcgcgaaa aggaccggct gatcaaacgc ctggtcgcga ccgagaaggg gcagttgccc       600
     gccgccatcg gcaagatttc cgatcacccg gccctgcatc tcctcttcgc cgtggaaacc       660
     acgctcgaca cgccggatgc cgaagaagcg gccgcgaagg atgagccaga cgcgatcgca       720
     gcagcagcag cggaagtcgg gaccgggctg ccttcgccga ccacgctgga cgagcctgcc       780
     gaaacgccgc tgcgagaaga tacatccgaa gccgaggcga cgacagatcc agccgcgacc       840
     gatgagccga ccgatgcgcc gagccttggt gaagaacacg gcgaattggc tctccggtcc       900
     ggcgacgaag cggcagattt ggcgccgagc gccgaggccg ccgagcccgc gcctgaagtg       960
     gcaacatcag atgccgacag tgccgcggcc gcggcgtcgg gcttcacctt cacgccgggt      1020
     agccgggctg tccgcttcgt gtggaaaatc gacgcggagg ggtgtttcag cgaaatctcc      1080
     gaggaatttg cggccgccgt cggcccgaaa tcggccgacg tggtcggcct gaccttctcc      1140
     gagcttgcgg ctcgctacga cctcgatccc gacaacaagg tcaacgcgct tctgcatcga      1200
     cgcgacacct ggtccggcaa gaccatcctg tggccgatcg agggaacgag cctcaaggtg      1260
     ccggtcgatc tcgcagcgct accgacctat tcccgttcgc gcgaattcga cggctttcgc      1320
     ggcttcggca tcgtgaggat cgccgacgcg gtcgaggacg aaaaggcgag cgggctatcg      1380
     cttggccaca tcgacacgcc ccgaaacgaa ggcatgcccg ccgaagcacc gtccgacgac      1440
     gcgcctcgcg aaccggcatc gctggcctcc gacggaaccg ataccccgcg gagcgaggcc      1500
     gaaccgcctt cggcggagga cccctttgcc ggcgagcggc ccgcccttcg catcgtcgac      1560
     ataccggcgc ggccgccttc cgacaaggtg atcgatctcg acgagcaccg gccggggtca      1620
     tccggaacgc tgacccgcgg cgaacaggcg gccttccgcg agatcgcgcg gcagctcggc      1680
     gcccagttca gcgagacgac accgccggct gccgcggacg aggacgggaa gcgcccggtt      1740
     gacgcggcgt cccaagccga agctgccggc gatatggaaa gcctgtcgtc ggaagacgct      1800
     actgccgccc ggcaggagga gacgatgccc ggggccggcg acgaggcgcc ccctgccccg      1860
     cgcggcggcg tcggcatgag cagcgaaatc ctcgatcgac tgcccgtcgc cctccttatt      1920
     catcacggcg acgagttgct gcacgccaat ccggaatttc tgcggctgac cggctaccgg      1980
     aagctcgagg ccttccagca ggcgggaggg ctggaagcgc tcttcgccta tggtgccgaa      2040
     tccggagagc atgagccgga cgggacgatg acgctggtgc gcgccaatgg tccgcttgca      2100
     ccggtcagcg cccatctgca ttcgatccag tgggagggga gaagcgcact gatgctcgcc      2160
     ttggctccgg cagccgcgcg cgccgccgat atgccttcgg ccggtgcgga cgcctcggcg      2220
     ggaggcgaag cgcggttgcg gatggaaatc gacgagttgc gttcgatcct cgaaacggcc      2280
     accgacggcg tggtggtcct cggacaggac ggcgacatcc gcacgatgaa cggctcggca      2340
     agcgcgctct tcaactatga cgaagacgag atgcgcggaa agccgtttgc cgccctcttc      2400
     gcccatgaga gccagaaggc ggtgatcgac taccttcaag gcctttccgg acatggtgtg      2460
     gcaagcgtgc tcaacgacgg ccgggaagcg atcggccgcg aggcgggcgg cggcttcctt      2520
     ccgctgttca tgaccatcgg gcggctctcc tcctctaacg gctattgcgc cgtcatccgc      2580
     gacatcaccc agtggaagcg gaccgaggag gaactgcgca acgccaagcg ctccgccgag      2640
     accgcgaacg cccacaagac cgagttcctc gcacgggtga gccacgagat ccgcacgccg      2700
     ctcaacgcca tcatcggctt ttccgacatg atggcgagcg agcatttcgg gccgatcggc      2760
     aacccgcgct acatcgaata tgccggcgac atcggccggt cgggtcggca cgtgctcgac      2820
     atcgtcaacg acctgctcga catctcgaag atcgaggcgg gcgagatgga gctcgatttc      2880
     agtgccgtcg acctcaacga ggcggtttcc gaagcggtct cgctggtgca gcctcaggcc      2940
     aacagccaac gcgtcatcat ccgcacctcg ctgtccggct cggtgccgga ggtcgtggcc      3000
     gacggccggt cgatcaagca gatcgcgctc aacatcctgg cgaacgccat ccgcttcacg      3060
     ccttccggcg ggcagatcgt cgtgtcgacg tcctacgaga cgaacggcag cgtcatcctg      3120
     aggatccgcg acacgggaat cggcatgacg cgcaacgagc tcgatcaggc gatgaaaccg      3180
     ttccgccagg tgacgaccgg cgggcgcaag cgcggcgagg gcaccggcct cggcctgccg      3240
     ctgacgaagg cgatggccga ggcgaaccgc gcccagttcg gcatcagctc cgcgccgaac      3300
     gagggaacgc tggttgaaat atccttcccg tcgcaacgcg tcttggcgaa ctga            3354
//

If you have problems or comments...

PBIL Back to PBIL home page