(data stored in ACNUC7421 zone)

EMBL: CP001389.PE330

CP001389.PE330       Location/Qualifiers
FT   CDS_pept        384382..384828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03360"
FT                   /product="hypothetical protein"
FT                   /note="similar to phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24134"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL9"
FT                   /protein_id="ACP24134.1"
FT                   /translation="MATKKTEDAFALSFDPAKFADSFRDFAEKGAAQSKDAYAKMKTAA
FT                   EEATKTVEATLESAQSGSVELGLKAINALRTNAENSLSHMEALLGVKSLSELVELQTAF
FT                   IRKQAELAVEQAKTMQEATRKVAENVAKPGKEAAEKVVSTFKKA"
     atggctacca agaagaccga agacgcattc gccctttcct ttgacccggc caagtttgcc        60
     gacagcttcc gcgacttcgc cgaaaagggc gccgcgcagt cgaaggacgc ctatgccaag       120
     atgaagaccg ccgccgaaga ggcaacgaag accgtcgaag cgacgctcga aagcgcccag       180
     tccggctccg tcgagctcgg cctcaaggcc atcaacgcgc tgcgcaccaa tgctgagaac       240
     tcgctctcgc acatggaagc gctgctcggc gtgaagtcgc tctccgaact cgtcgaactg       300
     cagaccgcct tcatccgcaa gcaggctgaa ctggctgtcg agcaggccaa gacgatgcag       360
     gaagccaccc gcaaggtcgc cgagaacgtt gccaagcccg gcaaggaagc cgccgaaaag       420
     gtcgtctcca ccttcaagaa ggcctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page