(data stored in ACNUC7421 zone)

EMBL: CP001389.PE331

CP001389.PE331       Location/Qualifiers
FT   CDS_pept        complement(385185..386066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03380"
FT                   /product="putative LysR family transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24135"
FT                   /db_xref="GOA:C3MGM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM0"
FT                   /protein_id="ACP24135.1"
FT                   /translation="MDWDDVRVFLAVARTGQILAASKRLGINHATLSRRVTALEETLKT
FT                   RLLVRRPNGCELTAEGEIFLSAAERMETEMLAAQSQIGRIDTAIAGTVRIGAPDGFGVS
FT                   FLAPRLGRLTARHPELKLQLVPVPRSFSLSQREADIAITIERPEQGRLVSSKLTDYTLG
FT                   LYASADYLARYGTPRTIDDLKNHRRIGYVEDLIFTPSLNFSAEIMRSWDASFEISSATG
FT                   QTEAVRSSAGVGILHNYIARHYPELTRLLPDTTIRRAYWTTYHESARELVRVRTVVSFL
FT                   QELLTAEHQIFV"
     atggactggg acgacgtcag ggtgtttctc gcagtggcac ggacgggcca gatcctcgcc        60
     gcctcgaaga ggctcggcat caatcacgcg acgctgagcc ggcgcgtcac cgcgctcgag       120
     gagacgctga agacgcggct tctcgtcagg cgcccgaacg gctgcgaact gacggccgaa       180
     ggcgagatct tcctttccgc cgccgagcgc atggaaaccg aaatgctcgc cgcccaatcg       240
     cagatcgggc ggatcgacac ggcaatcgcc ggcacggtgc gcatcggcgc cccggacggc       300
     ttcggcgtct ccttcctggc gccgcggctc gggcggttga cggcgcgaca tccggagctc       360
     aagctgcagc tcgttccggt tccacgctcc ttctcgctgt cgcagcgcga ggccgacatc       420
     gccatcacca tcgagcggcc cgaacagggg cggctcgttt cgtccaagct gaccgactat       480
     acactggggc tctacgcatc ggcggattat cttgcccgct acggcacgcc gcggacgatc       540
     gacgatctca agaaccatcg ccgcatcggt tatgtggaag acctgatctt tacgccctcg       600
     ctcaatttct cagccgagat catgcgcagc tgggacgctt ccttcgagat ctccagcgcc       660
     accggtcaga ccgaggcggt ccgctccagc gccggcgtcg gcatcctgca caactacatc       720
     gcccggcact atccggagct gacgcggctg ttgcccgaca cgacgatccg ccgcgcctac       780
     tggaccacct atcacgaaag cgcccgcgaa ctggtgcgcg tgcgcacggt cgtctcattc       840
     ctgcaggaac tgctgacggc tgagcatcag atttttgtgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page