(data stored in ACNUC7421 zone)

EMBL: CP001389.PE333

CP001389.PE333       Location/Qualifiers
FT   CDS_pept        387858..388292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03400"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24137"
FT                   /db_xref="GOA:C3MBV6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MBV6"
FT                   /protein_id="ACP24137.1"
FT                   /translation="MDERSQSHATWDCKYHVVFSSKYRTKRLYGDLRRELGDLLHRLAL
FT                   QKDCRIEEGHLMPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGYHFW
FT                   ARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
     atggatgaac gatcgcaatc acacgcgacg tgggactgca aataccatgt ggtcttttca        60
     agtaaatacc gaacgaaacg tctttacggt gacttgcgcc gtgaattggg tgaccttttg       120
     catcggcttg ctctgcaaaa ggattgccgg atcgaggaag ggcaccttat gcccgaccat       180
     gtgcatatgc tgatctcgat cccgccgaag tactcggtgt cgcacattgt gggcttcctg       240
     aagggcaaga cagcccttta cgtggccaac aaatatgccc gcaagcggcg ctacaaaggc       300
     tatcactttt gggcgcgtgg gtacttcgtc tcaacggctg gctatgatga gcaggtcgtc       360
     agacgctata tccgtaatca agaaaaggcc gacaaagctt ccgactttgc cgacctcttt       420
     aaccgtagct actaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page