(data stored in ACNUC7421 zone)

EMBL: CP001389.PE334

CP001389.PE334       Location/Qualifiers
FT   CDS_pept        388518..389633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03410"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24138"
FT                   /db_xref="GOA:C3MGM3"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM3"
FT                   /protein_id="ACP24138.1"
FT                   /translation="MVLAEPFPAQIGQGSFGRSAQGDYQRLSFTGSGKEYFGIWIVNIL
FT                   LTIVTLGIYSAWAKVRRNRYFYGNTVLLGRGFEYHARGGQILIGRLIVFAYLVVYNILL
FT                   TFVPLAGIALLLLLLCFVPWLVARGLRFSARVTSYRNVRFDFVGRAGGAFLAFIVGPVI
FT                   AALTLGILAPLASRWTYRYIGNNLRYGQKAFSTDPSIGTIYKSWAISAAIIILGLLIVG
FT                   FFAFLNFAVFVTAIESPDLIPAEMQVSIVVLVVLGYFLFFAIFGVAALVYRAGVRNVAW
FT                   SAATFDGKHRLLSDLSRLRYTWIAISNVVVTLVTLGLMRPWAAVRMARYVNEQTGVRFD
FT                   GNVGEIFSAIAQEGSAVGSEFMDIEGFDFGF"
     atggttttgg ctgaaccatt cccggcacag atcgggcagg gcagtttcgg gcgctcggcg        60
     cagggggatt accagcgcct ctcgtttacc ggcagcggca aagaatactt cgggatctgg       120
     atcgtcaata tcctgctgac gatcgtcacg ctcggcatct attcggcctg ggcaaaggtt       180
     cgccgcaatc gctatttcta cggcaataca gtgctgctcg gccgcggctt cgagtatcac       240
     gccaggggcg ggcagattct gatcggccgt ctgatcgtct tcgcctatct ggtcgtctac       300
     aacatcctgc tgaccttcgt gccgctcgcc ggcattgcac tgcttttgct gctcctttgc       360
     ttcgttccct ggcttgtcgc ccgcggcttg cgctttagcg cccgggtgac cagctaccgc       420
     aatgtccgct tcgatttcgt cggtcgcgcc ggcggtgcct ttctcgcctt catcgtcggg       480
     ccggtcatcg cggcgctgac gcttggcatc ctggcgccgc tcgccagccg ctggacctat       540
     cgctatatag gcaacaacct gcgctacggg cagaaggcct tttcgaccga tccctccatc       600
     ggcacgatct acaaatcctg ggcgatctcg gcggcgatca tcattctcgg tctgctgatc       660
     gtcggcttct tcgccttcct caactttgcg gtttttgtga cggcgatcga gagccccgat       720
     ctcattcccg ccgagatgca ggtgtcgatc gtcgtgctcg tggtgctcgg ctacttcctg       780
     tttttcgcga tcttcggggt cgcggcgctc gtctaccgcg ccggcgtgcg caacgtcgcc       840
     tggtccgccg ccactttcga cggcaagcac cggctcctga gcgatctctc gcgcctgcgc       900
     tacacctgga ttgccatctc gaacgtcgtc gtcacccttg ttacactcgg tttgatgcgg       960
     ccgtgggccg ccgtccggat ggcgcgctac gtcaatgaac aaaccggcgt ccggttcgac      1020
     ggcaatgtcg gcgagatttt ctccgccatc gcccaggaag gttcggcggt cggttccgaa      1080
     ttcatggata tcgaaggctt cgactttggc ttctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page