(data stored in ACNUC7421 zone)

EMBL: CP001389.PE337

CP001389.PE337       Location/Qualifiers
FT   CDS_pept        complement(391364..392407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03440"
FT                   /product="extracelluar solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24141"
FT                   /db_xref="GOA:C3MGM6"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM6"
FT                   /protein_id="ACP24141.1"
FT                   /translation="MLASKTLIGTLSVAAAILAFSAPARAEGEVNIYSYRQPDLIKPLL
FT                   DAFTKETGIAANVLFLDKGLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPLVNE
FT                   TINKDIPAHFRDPDGNWFGLTTRGRVVYASKERVPQNDITYEELADPKWKGKFCTRDGQ
FT                   HSYNIGLFASMIAHHGEAETEKWLTGFRDNLSKKPDGGDRDQAKAIFAGECDIALGNSY
FT                   YVGLMLTNDKEPQQKEWASAIKVLFPNAKDRGTHVNISGMALAKNAPNKENAVKLMEFL
FT                   SEGEAQKIYAEQVFEYPVLPGAEPSDVVKSFGTIKPDSLPLAEIAANRKKASELVDKVG
FT                   YNDGPQD"
     atgcttgcct caaaaacgtt gatcggcacc ctgtcggtcg cggcggcgat ccttgctttc        60
     agcgcgcctg cccgggccga gggcgaggtc aatatctatt cctaccgcca gcccgatctc       120
     atcaagccgc tgctcgatgc cttcaccaag gagaccggca tcgccgccaa tgtgctcttc       180
     ctcgacaagg ggctggtcga gcgcatccag gcggaaggcg cgaattctcc ggccgacgtc       240
     attttgaccg tcgacatcag ccgcctgacc gaggcgaagg acgccggcgt gacccagccg       300
     ctcgtcaatg agacgatcaa caaggacatc ccggcgcatt tccgcgatcc ggacggcaac       360
     tggttcggcc tgacgacgcg cggtcgcgtc gtctatgcct cgaaggaacg cgtgccgcag       420
     aacgacatca cctatgaaga acttgccgac ccgaaatgga agggcaagtt ttgcacccgc       480
     gatggccagc attcctacaa tatcggcctg ttcgcctcga tgatcgcgca tcacggcgag       540
     gcggagacgg agaagtggct gacgggattc cgggacaatc tctccaagaa gcccgatggc       600
     ggcgatcgtg atcaggcaaa ggcgatcttt gccggcgaat gcgatatcgc gctcggcaac       660
     agctactatg tcggtctcat gctgaccaac gacaaggagc cgcagcagaa ggaatgggct       720
     tcggccatca aggtcctctt cccgaatgcg aaggatcgtg gcacgcacgt caacatctcc       780
     ggcatggcgc tcgcgaagaa cgccccgaac aaggagaatg ccgtcaagct gatggaattc       840
     ctgtcggaag gcgaagcgca gaagatctac gccgagcagg tcttcgaata tccagtgctg       900
     ccgggcgccg agccctcgga cgtcgtcaag tcctttggaa cgatcaagcc ggactccctg       960
     ccgcttgccg agattgcggc aaaccgcaag aaggcttcgg aactcgtcga caaggtcggc      1020
     tataacgacg gcccgcaaga ctaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page