(data stored in ACNUC7421 zone)

EMBL: CP001389.PE34

CP001389.PE34        Location/Qualifiers
FT   CDS_pept        37702..38094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00340"
FT                   /product="predicted glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23838"
FT                   /db_xref="GOA:C3MF01"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF01"
FT                   /protein_id="ACP23838.1"
FT                   /translation="MKQTIARIAILVPDYDEGLAFYCGRLGFELIEDTDLGAGKRWVLV
FT                   RPTGATETALLIAKAEGERQNAAIGNQAGGRVGFFLFTDDFARDHAAMLAAGVEFLEPP
FT                   RHEAYGTVAVFTDPFGNRWDLLQPAS"
     gtgaagcaga ccatcgcccg catcgccatt ctcgtgccgg actatgacga gggtcttgcc        60
     ttctattgcg gccggttggg cttcgagctg atcgaggaca ccgatctcgg tgccggcaag       120
     cgttgggtgc tggtgcggcc gacgggcgcg accgaaaccg cgctgctcat cgccaaggcc       180
     gagggcgaac ggcagaacgc cgcgatcggc aaccaggccg gcggccgcgt cggcttcttt       240
     ctcttcaccg acgatttcgc ccgcgaccac gcggcgatgc ttgccgccgg cgtcgaattt       300
     ctcgagccgc cgcgccatga ggcctacggg actgtggcgg tcttcaccga tccgttcggc       360
     aatcgctggg acctgctgca gccagcctct tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page