(data stored in ACNUC7421 zone)

EMBL: CP001389.PE344

CP001389.PE344       Location/Qualifiers
FT   CDS_pept        398851..399195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03510"
FT                   /product="putative endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24148"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN3"
FT                   /protein_id="ACP24148.1"
FT                   /translation="MEIKRFETGPRMSQAVVYNNTVYLAGQVGNAGDDVVTQTKQALAE
FT                   VDRLLALAGTDKTRILSATVWLADMADFAKMNSVWDAWAPQGHTPARATGEAKLATPEY
FT                   LVEVIVTAAV"
     atggaaatca agcgcttcga gaccggtccg cggatgagcc aggccgtggt ctacaacaac        60
     acggtctatc tggccggcca ggtgggcaac gccggagacg atgtcgtcac gcagaccaag       120
     caggcgctcg ccgaggtcga ccgcctgctt gcgctcgccg gtacagacaa gacgcgtatc       180
     ctctccgcca cagtctggct cgccgatatg gcggatttcg ccaagatgaa ctcggtctgg       240
     gatgcctggg cgccgcaggg tcacacgccc gcgcgcgcca ccggcgaagc caagctggca       300
     acgcctgaat acctcgtcga ggtcatcgtg acggcagccg tctag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page