(data stored in ACNUC7421 zone)

EMBL: CP001389.PE345

CP001389.PE345       Location/Qualifiers
FT   CDS_pept        399338..399508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24149"
FT                   /db_xref="GOA:C3MGN4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN4"
FT                   /protein_id="ACP24149.1"
FT                   /translation="MLYWLPRLCLLLIAGVVLGFGLFPRTSEDVAYTLLIILVGLGLLS
FT                   VTLHIFPPEEH"
     atgctctatt ggctgccgcg gctctgtttg ctgctgatcg ccggtgtggt tttgggcttt        60
     ggccttttcc cgcggacgtc cgaggacgta gcttatacgt tgttgataat ccttgtgggg       120
     ctggggctgc tttccgtgac gctccacata tttccgccag aagagcattg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page