(data stored in ACNUC7421 zone)

EMBL: CP001389.PE346

CP001389.PE346       Location/Qualifiers
FT   CDS_pept        399663..400787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03530"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24150"
FT                   /db_xref="GOA:C3MGN5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN5"
FT                   /protein_id="ACP24150.1"
FT                   /translation="MDSKVVAAVRSRKRSAEKELALAQATTAARKRDGMDLVVAWSVVG
FT                   LFVVACSAVVYAMAAILMPIAFAIVVGIVLGRAADELARFGLPPMLGGLLLALFFVLGL
FT                   SSLVNTLLGPITELAREAPKLAESVVERVLPFIERFEWGRIALARSVGADAFADVVVKN
FT                   AGPILGAAAASVTPALIQTLIFLAALVLFLLGRVQLRSTIILAFPSRDGRLSAIRIMNA
FT                   IEDGLTRYFSTASLIYLALGGFTMMIALVGGLPMPPLWGLFAFVSSFIPYLGVTFMTLS
FT                   LLVGGLMTHEALVVALAPATAFFLIHLAMENLVVPAILGRRFEVNPFLIFVAILFWTWM
FT                   WGAVGAILAMPLSLIAMTIFEQLREPPPEPQLPG"
     atggacagca aagttgtagc ggctgtccgt agccgcaagc gcagcgccga aaaggaactc        60
     gccctggcac aggcgacgac ggcggcgcga aagcgcgacg gcatggatct cgtcgtcgcc       120
     tggagcgtcg tcgggttgtt cgtcgtcgct tgctcggcgg tcgtttacgc gatggcggca       180
     attctgatgc ccattgcgtt tgccatcgtc gtcgggatcg tgctcggcag ggcagccgac       240
     gaactggcgc gtttcggtct tccgccgatg ctgggtggtc ttttgctggc gctcttcttc       300
     gtgctcggcc tatcgtcgct cgtcaacaca ctcctggggc cgatcaccga gctcgcccgc       360
     gaggccccga aactcgccga aagcgtcgtg gagcgcgtgc tgcctttcat cgaacgcttc       420
     gagtggggca ggattgcgct cgcgcgaagc gtgggggccg acgctttcgc agacgtcgtc       480
     gtcaagaatg cgggcccgat cctcggcgcg gccgccgcga gcgtgacgcc ggcactaatc       540
     cagacgctga tcttcctggc ggcgctcgtc ctgttcctcc tcggccgcgt ccagttgcgc       600
     agcacgatca tcctagcttt ccccagtcgc gacggccgcc tgagcgcgat ccggatcatg       660
     aacgccatcg aagacgggct gacgcgctat ttctcgacgg ccagcctgat ctacctggcg       720
     ctcggcggct tcaccatgat gatcgcgctg gtcggcgggc tgccgatgcc gccgctctgg       780
     gggcttttcg ccttcgtctc gagtttcatt ccctatctcg gcgtcacctt catgacgctg       840
     tcgctgctcg tcgggggcct tatgacccac gaagcgctgg tcgtggcgct cgcgccggcg       900
     accgccttct tcctcattca tctggccatg gagaacctcg tcgtcccggc gatcctgggg       960
     cgacgctttg aggtcaaccc cttcctgatc ttcgtcgcca tcctgttctg gacgtggatg      1020
     tggggcgcgg tcggggcgat cctcgccatg ccgctgtcgc tgatcgcgat gaccatcttc      1080
     gagcagctgc gcgagcctcc gcccgaaccg caattgcccg gatga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page