(data stored in ACNUC7421 zone)

EMBL: CP001389.PE347

CP001389.PE347       Location/Qualifiers
FT   CDS_pept        complement(400792..401589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03540"
FT                   /product="predicted two-component signal transduction
FT                   response regulator, contains receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24151"
FT                   /db_xref="GOA:C3MGN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN6"
FT                   /protein_id="ACP24151.1"
FT                   /translation="MSLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIEDISL
FT                   FPSASNDRISLYKLFCSLFDKLKVDRSHLSSPFAWEKRAAANLSLIAPTPRQAFLLISV
FT                   EGFSSGEAAEIMSIDQGAFAKLLSSASEEISRQVATDIMIIEDEPLIAMDIEDMVTSLG
FT                   HRVTGIARTHREAIDIYRQTSPKMVLADIQLADGSSGIDAVNDILTQAAVPVIFITAFP
FT                   ERLLTGNKPEPAFLVTKPFNPEMVKALISQALFFDEQAHAASR"
     atgtcacttt ccaccaggat tgcgccgcat cttccttatc ttaggcgtta tgcccgcgcc        60
     gtcacagggt cgcaagcggc aggcgatgcc tatgtcgccg ccgtcttgga ggcgttgatc       120
     gaagacatca gcctgttccc ctcggcatcg aacgatcgca taagcctgta caagctgttc       180
     tgctccctct tcgacaagct caaggtcgat cggtcccatt tgagctcgcc cttcgcgtgg       240
     gagaagagag ccgccgccaa cctgtcgctg atcgcgccaa cgccccggca ggctttcctg       300
     ctgatctctg tcgaggggtt ttcaagcggc gaagcggcgg aaatcatgtc gatcgaccag       360
     ggcgcgtttg ccaagcttct gtccagtgct tcggaagaga tttcgcgcca ggttgccacc       420
     gacatcatga tcatcgaaga cgagccgctc atcgccatgg atatcgagga tatggtgacg       480
     agcctgggac accgggtcac cggcattgcc cgcacgcatc gcgaggcgat cgatatctac       540
     cggcagacat cccccaagat ggttctcgcg gatatccagc tcgccgacgg gagttccggc       600
     atcgacgcgg tcaacgacat cctgacgcag gcggccgtgc cggtgatctt catcaccgct       660
     ttccccgaac ggctgctgac gggcaacaag ccggagccgg ccttcctggt gacgaagccc       720
     ttcaatccgg agatggtcaa ggcgctgatc agccaggcgt tgttcttcga cgaacaagcg       780
     cacgcggcaa gtcgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page