(data stored in ACNUC7421 zone)

EMBL: CP001389.PE351

CP001389.PE351       Location/Qualifiers
FT   CDS_pept        403186..403350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24155"
FT                   /db_xref="GOA:C3MGP0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP0"
FT                   /protein_id="ACP24155.1"
FT                   /translation="MLYYALIFLVVAIIAGVLGFGGIAGTSAGIAQILFFLFLIFLVVS
FT                   LVMGLFRRT"
     atgctctact atgccctcat ctttcttgtg gtcgccatca tagccggcgt tctcggcttc        60
     ggcggcatcg ccggcacctc ggcgggaatc gcccagatcc tgttcttcct gttcctgatc       120
     ttcctggtgg tctctctcgt tatggggctc ttccgccgca cctga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page