(data stored in ACNUC7421 zone)

EMBL: CP001389.PE354

CP001389.PE354       Location/Qualifiers
FT   CDS_pept        complement(405399..405962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03610"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24158"
FT                   /db_xref="GOA:C3MGP3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP3"
FT                   /protein_id="ACP24158.1"
FT                   /translation="MDQILADILVSTRTPYPVIFARLCGAIVLGALIGIEREKRQRPAG
FT                   LRTHILVSLASAIFAVVAVESVHMTSLSGPEVRIDPIRVVEAVTAGVAFLAAGMIVFSK
FT                   GEVKGLTTGAGMWLAGAVGISVGFGFWMIATFAAVASLIVLFILGRMEVALQWKEPEGE
FT                   GNGARETGRHPAPGAPAGSDDGSR"
     atggaccaga tccttgccga catccttgtt tcgacgcgga cgccctatcc ggtgatattc        60
     gcgcgtttgt gcggtgcgat cgttctcggc gccctcatcg gcatcgagag ggagaagcgc       120
     cagcgcccgg cgggcctcag gacgcacatc ctggtgagcc tagcttcggc gatcttcgcg       180
     gtggttgcgg tcgagagcgt ccatatgacg agcctgtcgg gccccgaagt ccgcatcgac       240
     ccgatccgtg tcgtcgaagc ggtgaccgca ggggtcgcct tccttgccgc cggcatgatc       300
     gtgttttcga agggcgaggt gaaaggcctg acgacgggcg ccggcatgtg gcttgctggg       360
     gccgtcggca tttcagtggg tttcggcttc tggatgatcg ccactttcgc cgccgtggcc       420
     agtctcatcg ttctcttcat cctcggccgg atggaggtgg cgttgcagtg gaaggagccc       480
     gaaggtgaag ggaacggcgc ccgggaaacg ggccgccacc ctgcgcccgg ggcgccggca       540
     gggtcggatg acgggagccg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page