(data stored in ACNUC7421 zone)

EMBL: CP001389.PE355

CP001389.PE355       Location/Qualifiers
FT   CDS_pept        complement(406056..406442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24159"
FT                   /db_xref="GOA:C3MGP4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP4"
FT                   /protein_id="ACP24159.1"
FT                   /translation="MDPQDQLKERPPVDPVTGQPAPPPEVHEARASRSSWPLLVILLAG
FT                   LVLALIAWLPAELTRDAEDTPTSSTTTTQPATDEPATGTEATPPAGGTTQEPAPAAPET
FT                   QPQPTPPAPAPEGTAPQPQTPPAQ"
     atggacccac aggaccagtt gaaggaaagg ccgccagtcg atccggtcac cggacagccg        60
     gcgccgcccc ccgaagtaca tgaagcgcgc gcgagccgca gttcgtggcc gctgctggtc       120
     atccttctcg ccggcctggt gctggcgctg atcgcctggc tgccggccga actcacccga       180
     gacgcggagg atactcccac ctcgtcgacg acgacaacac aacccgcgac cgatgagccg       240
     gccacaggca ccgaagcgac gccaccggct ggaggaacga cgcaggagcc ggccccggcc       300
     gcgcctgaaa cacagcctca gccgacaccg ccggcgccgg caccggaagg aacggcgccg       360
     cagccgcaga ctcctccggc gcagtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page