(data stored in ACNUC7421 zone)

EMBL: CP001389.PE356

CP001389.PE356       Location/Qualifiers
FT   CDS_pept        406728..407873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24160"
FT                   /db_xref="GOA:C3MGP5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP5"
FT                   /protein_id="ACP24160.1"
FT                   /translation="MKMTTAYETGTFVGRAWRPDVEGPSLVTVRDGELIDITSKRVPTM
FT                   RDLLDLSDPVAHARSASGEAIASVDAVMARPAGGSDEVHLLAPCDLQAVKACGVTFARS
FT                   MIERVIEERAAGDATRAETIRARMTAIIGDSLRNLKAGSPEAAGVKAALIDEGVWSQYL
FT                   EVGIGPDAEVFTKAQPLSSVGWGAAVGLHPISRWNNPEPEIVLAVSADGRIKGATLGND
FT                   VNLRDVEGRSALLLGKAKDNNASCAIGPFIRLFDETYSIDDVRHADLDLLIEGPDGFHL
FT                   KGASTMREISRDPLDLVAQTIGSHHQYPDGLMLFMGTLFAPVEDRGEPGQGFTHKIGDV
FT                   VTISSPALGSLVNTVRLSTDCPPWTFGTAALMRNLAKRGLL"
     atgaaaatga ccacggccta tgaaaccgga acctttgtcg gacgggcgtg gcgcccggac        60
     gtcgagggac cgagcctggt gaccgtccgg gacggcgaat tgatcgacat cacctcgaag       120
     cgggtgccga cgatgcgcga cctcctcgat ctttccgatc ccgtcgctca tgcccgttcg       180
     gcttccggag aggcgattgc ctccgtcgat gccgtcatgg ccaggccggc ggggggcagc       240
     gacgaggtcc atcttcttgc cccttgcgac ctccaggcgg tcaaggcctg cggcgtcacc       300
     ttcgcccgct cgatgatcga gcgcgtcatc gaggagcgcg ccgccggcga cgcgacacgc       360
     gccgagacga tccgcgcccg gatgacggcg atcatcggcg acagcctgag aaacctgaag       420
     gcgggttcgc cggaagctgc cggcgtcaag gccgccctga tcgacgaggg cgtctggtcg       480
     caatatctcg aagtcggcat cgggcctgac gccgaggtct tcaccaaggc ccagccgctc       540
     tcgtcggtag gctggggcgc cgcggtcggc ctgcatccga tttcgcgctg gaacaacccg       600
     gagccggaga tcgtccttgc ggtttccgcc gacgggcgca tcaagggcgc gacgctcggc       660
     aacgatgtca acctgcgcga tgtcgagggg cgctcggcgc tgctgctcgg caaggccaag       720
     gacaacaatg cgtcctgcgc gatcggcccc ttcatccgcc tcttcgacga gacctactcg       780
     atcgacgacg tgcgccatgc ggacctcgat ctcctgatcg aaggcccgga tggctttcac       840
     ctgaaggggg cgagcaccat gcgcgagatc agccgcgacc ccctcgacct cgtcgcccag       900
     acgatcggat cgcatcacca gtacccggac gggctgatgc tcttcatggg aacgctcttc       960
     gcgcccgtcg aggaccgcgg cgagccgggc cagggcttta cccacaagat cggcgacgtg      1020
     gtgaccattt ccagccccgc cctcggcagt ctcgtcaaca cggtgcgcct gtccaccgat      1080
     tgcccgccct ggaccttcgg caccgcggcg ctgatgcgca atctcgccaa acgcgggctg      1140
     ctgtag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page