(data stored in ACNUC7421 zone)

EMBL: CP001389.PE357

CP001389.PE357       Location/Qualifiers
FT   CDS_pept        407934..408326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24161"
FT                   /db_xref="InterPro:IPR014587"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP6"
FT                   /protein_id="ACP24161.1"
FT                   /translation="MDRRGLGVEMKVAIGLAAASLFVAVAAHPLRAEPLRSVDEVSEAL
FT                   GKCWTPPAGIKGSFVTLKFGFRGNGTLMGPPQPTAIRVTGDADQREAFVAAATEALEKC
FT                   MPLEFTQELAGEIAGNVFTLQFFSAD"
     atggatcgtc gggggctggg ggtcgaaatg aaagtcgcta tcgggttggc cgccgccagc        60
     ctgttcgttg cagtcgcggc gcatccgctg cgggcagaac cgttgcggag cgtcgatgaa       120
     gtcagcgaag cactcggcaa gtgctggacg ccgcccgccg gcatcaaggg ctccttcgtc       180
     accctgaaat tcggcttccg aggcaacggc accctgatgg gcccgcccca gccgacggcg       240
     atccgcgtca ccggcgatgc ggaccagcgc gaggccttcg tcgccgccgc gaccgaggct       300
     ctcgagaagt gcatgccgct tgaatttaca caggagcttg ccggcgaaat cgccggcaat       360
     gtcttcacgc tgcagttctt ttcggcggac tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page