(data stored in ACNUC7421 zone)

EMBL: CP001389.PE359

CP001389.PE359       Location/Qualifiers
FT   CDS_pept        complement(411567..411875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24163"
FT                   /db_xref="GOA:C3MGP8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP8"
FT                   /protein_id="ACP24163.1"
FT                   /translation="MLRHADNSKGTPAAGSVSDAAPAGITATDVAADWLSLAAAPTFAI
FT                   MALLAGVLGGPADMLCSSAGDAPAITGMVPMYVLMSAFHSAPWLRLISGQRRPACRS"
     atgttgcgcc acgccgacaa ctcgaagggg acgccggccg caggcagcgt atccgacgct        60
     gccccggctg gcatcaccgc cacagacgtc gccgccgact ggctgtccct cgcggcggcg       120
     ccgacttttg ctatcatggc gctgcttgcc ggcgttctcg gcggtccggc ggacatgctc       180
     tgttcgtccg cgggtgacgc gccagccatc accggcatgg ttccgatgta cgtgctgatg       240
     agcgccttcc attcggcgcc ctggctgagg ctgatctccg gccagcgaag acccgcatgc       300
     cggtcctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page