(data stored in ACNUC7421 zone)

EMBL: CP001389.PE36

CP001389.PE36        Location/Qualifiers
FT   CDS_pept        39262..39777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00360"
FT                   /product="predicted universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23840"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF03"
FT                   /protein_id="ACP23840.1"
FT                   /translation="MRRCNVRRMVSTRLSRLEGHRRKFMAVIDDTPECGRAVHYAGMRA
FT                   KNSNGGLVLLYVIADGDFQQWLGVEEIMRAEAREEAEATLAKVAQTVRERIGIEPEIVI
FT                   REGIATDQIYALIEEDRDIAILVLAAGSAKEGPGPLVSSIAGKAAAFPIPVTVIPDLLT
FT                   DEEIDALS"
     gtgcggcgat gtaatgttcg ccgcatggtt tccacccgac tctcaagact ggaaggtcac        60
     cgccgcaagt ttatggcggt gatcgacgac acgccggaat gcggccgtgc cgtgcactat       120
     gcgggcatgc gcgcgaagaa ctccaacggc ggtctcgtac ttctctacgt gatcgccgac       180
     ggcgacttcc agcaatggct gggggtggag gagatcatgc gggcggaggc ccgcgaggag       240
     gccgaggcga cgctcgccaa ggtcgcacag acggtgcgcg agcggatcgg catcgaaccg       300
     gaaatcgtca tccgtgaagg catcgccacg gatcagattt acgcgttgat cgaggaggac       360
     cgggacatcg ccatcctcgt gctcgcggcg ggttcggcga aagaaggccc cggcccgctg       420
     gtgtcgtcga tcgcgggaaa ggcggcggct tttcccattc ccgtcaccgt cattcccgat       480
     cttctgaccg acgaggagat cgacgcgctg agctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page