(data stored in ACNUC7421 zone)

EMBL: CP001389.PE360

CP001389.PE360       Location/Qualifiers
FT   CDS_pept        complement(411882..412679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24164"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP9"
FT                   /protein_id="ACP24164.1"
FT                   /translation="MTEHRTGTREEWLAARLELLEAEKELTRRSDALARQRQALPWVRI
FT                   DKDYRFETDAGSASLRELFRGRSQLLVYHFMFGPDYTAGCPSCSAIADGFDGIVVHLEN
FT                   HDVAFSAISRAPLDKLEAYKRRMGWSFPWASSNDGDFNRDFSVWFTADEQRQGRIEYNF
FT                   RREPPAPEPLAGKTVQEWQLRGSEGPVAQIAAMTGTDVATYTRDRPGLSAFVLDDGVVY
FT                   HSYSSYARGLDGLWGMYQWLDRAPLGRNETGVWWRRNDEYGQG"
     atgacggaac acaggaccgg gacacgggaa gaatggctgg cagcgcggct ggaactgctg        60
     gaggccgaga aggagctgac acgccggagc gatgcgctgg cgcggcagcg ccaggccttg       120
     ccgtgggtga ggatcgacaa ggattaccgg ttcgagaccg acgcggggag cgcctcgctc       180
     agggagctct tccgagggcg ctcgcagctg ctcgtctatc acttcatgtt cgggcctgat       240
     tacacggccg ggtgcccgtc ctgctccgcg attgccgacg ggttcgacgg catcgtcgtc       300
     catctggaaa accacgacgt cgccttctcg gcgatatccc gcgcgccgct cgacaagctc       360
     gaggcctaca agcggcggat gggctggagc tttccctggg cgtcctcgaa cgacggcgac       420
     ttcaaccgcg acttcagcgt ctggttcacc gcagacgagc agcgccaggg ccgcatcgag       480
     tacaacttcc gccgcgagcc gccggcaccc gagccacttg caggaaagac cgtgcaggaa       540
     tggcagttgc gcggcagcga aggaccggtc gcccagatcg cggcgatgac cgggacggac       600
     gtcgccacct atacccgcga ccggccgggc ctcagcgcct tcgtgctcga cgacggcgtc       660
     gtctatcaca gctattccag ctatgcgcgt gggctggacg gcctatgggg catgtaccag       720
     tggctcgacc gggccccgtt gggacgcaac gagaccggtg tctggtggcg ccgcaacgac       780
     gaatatggcc aaggctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page