(data stored in ACNUC7421 zone)

EMBL: CP001389.PE361

CP001389.PE361       Location/Qualifiers
FT   CDS_pept        412774..413991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24165"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ0"
FT                   /protein_id="ACP24165.1"
FT                   /translation="MDSLITAAARALATGDPLGALKRVALRDDPPALALRGIAMAQLGD
FT                   FARAKVLLKNATRAFGPKEAVARARCVVAEAEIALVSRDLSFPAKALDAALATLEKHRD
FT                   WVNAAHARNLEVRRLLLVGRLDGAERALADIDPAPLPPASRAAYELAVAGIAIRRLRTK
FT                   AARAALARAGQAAREANIPALAAEVESASLVLETPAARLIAQGEARPLLLEEVEALLAS
FT                   QALVVDACRHVLRGEGTVVSLETRPVLFALARALAEAWPGDVPRGTLVARAFRAKHADE
FT                   SHRARLRVEIGRLRAELATLAEVRATKRGFALAPRAGEVVVLAPPVEGQHAAVLALLAD
FT                   GEAWSSSALAIALGASPRTVQRALEALAASDQVRSFGLGRARRWMTPPVPAFPTILLLP
FT                   GPLPGD"
     atggattcgc tgatcaccgc ggcggcccgc gcgctggcga caggcgatcc gctcggcgcc        60
     ctgaagcggg ttgcgctgcg cgacgaccca ccggcgctgg cgctgagagg catcgccatg       120
     gcgcagctcg gcgacttcgc ccgggccaag gtcctcctca agaatgccac tcgcgccttc       180
     ggcccgaaag aggcggtggc gcgcgccaga tgcgtcgtcg ccgaggcaga aatcgccctc       240
     gtctcgcgcg atctctcctt tcccgccaag gcgctcgacg cggcgctggc gacgcttgaa       300
     aaacaccgcg actgggtgaa tgccgcgcat gcgcgcaatc tcgaggtgcg gcgcctgctg       360
     ctggtcggcc ggctcgacgg ggccgagcgc gccctcgccg acatcgaccc cgcaccgctt       420
     ccgcccgcct cgcgggccgc ctacgagctg gcggttgccg gaattgcaat ccggcgcctc       480
     aggacgaagg cagcccgggc cgcacttgcg cgcgccggac aagccgcgcg cgaggccaac       540
     atccccgcac tggcggcgga ggtcgaaagc gcgtctctcg tgcttgagac gcctgcggca       600
     cggctgatcg cgcagggcga ggcgcgtccc ctcctgctcg aggaggtcga agcgctgctg       660
     gcgtcgcaag cgcttgtcgt tgacgcctgc cgccatgtgc tgcggggcga aggcaccgtg       720
     gtgtcgctcg agacgcggcc ggtcctgttc gccttggccc gcgcgctcgc cgaagcctgg       780
     cccggtgacg tgccgagagg cacgctcgtc gcgcgcgcct tccgggcgaa acatgccgat       840
     gaatcgcatc gcgcgcgctt gcgcgtcgag atcggccggc tgcgggcgga gcttgcgacg       900
     ctggcggagg tgagggcgac gaagcgcggc tttgcccttg cgccgcgggc cggcgaggtc       960
     gtcgtgctgg cgccgcccgt cgaagggcag catgcggcgg tgctcgctct tcttgccgat      1020
     ggcgaggcat ggtcgagttc ggcgctggcg attgcccttg gcgccagccc gcggacggtg      1080
     cagcgggcgc tggaagcgct ggcggcctcc gaccaggtcc ggtcattcgg cctcggccgg      1140
     gcgcgtcgct ggatgacccc gccggtgccg gcattcccga caatcttgtt actccccggt      1200
     ccgctgccgg gcgactag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page