(data stored in ACNUC7421 zone)

EMBL: CP001389.PE362

CP001389.PE362       Location/Qualifiers
FT   CDS_pept        414034..414666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24166"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ1"
FT                   /protein_id="ACP24166.1"
FT                   /translation="MKYSQAEILREYGPFPGADNVHGVTFDGEHVWFASGDKLNAFDPA
FT                   TGETVRAIDVAAHAGTAFDGRHLYQIAEDRIQKIDPKTGRVLSTIPAPGAGGDSGLTWA
FT                   EGTLWVGQHRGRKIHQIDPETGAILRTIESNRVVTGVTWIDGELWHGTWEDDASEVRRV
FT                   DPATGKVLETLEMPEGIGVSGLESDGGDRLFCGGGKSGKVRVVKKPR"
     atgaaatatt cccaggccga aattctccgc gaatatggac cctttccggg tgccgacaac        60
     gtgcatggcg tcactttcga cggcgagcac gtctggttcg catccggcga caagctcaac       120
     gccttcgacc cggcgaccgg cgagacggtg cgcgcgatcg atgtcgccgc ccatgccggc       180
     acggccttcg acgggcggca cctctatcaa atcgccgagg accgcatcca gaagatcgac       240
     ccgaagaccg gccgcgtgct ttcgactatc ccggcgcccg gcgccggcgg cgactcgggg       300
     cttacctggg ccgaaggaac gctctgggtc ggccagcatc gcggccgcaa aatccaccag       360
     atcgaccccg aaaccggggc cattctccgc accatcgagt ccaaccgcgt cgtcaccggc       420
     gtcacctgga tcgacggcga gctctggcac ggcacctggg aggacgacgc gagcgaggtg       480
     agaagggtcg atccggcaac cggcaaggtg ctggagacgc tcgaaatgcc ggagggaatc       540
     ggtgtatcgg gcctcgaatc cgacggcggc gaccggctct tctgcggcgg cggaaagagc       600
     ggcaaggtga gggtggtgaa gaagccgagg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page