(data stored in ACNUC7421 zone)

EMBL: CP001389.PE366

CP001389.PE366       Location/Qualifiers
FT   CDS_pept        418050..418433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24170"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ5"
FT                   /protein_id="ACP24170.1"
FT                   /translation="MLLYVTVGTNDLERAGAFYDAVLPTLGYRRQRQDETEIGYGADGD
FT                   VRVRFWVVTPFNREPATYGNGVSIALAAETRGAVDAFHAAALAAGGADEGAPGLRPFHA
FT                   HFYGAWVRDLDGNKIAAVCERPE"
     atgctgcttt acgtgacggt cggcaccaac gatttagaac gcgctggcgc gttctatgat        60
     gccgtgcttc cgacccttgg ctaccgccgc cagcggcagg acgaaaccga gatcggctac       120
     ggcgcagacg gcgatgtgcg cgtccgcttc tgggtggtca ccccgttcaa ccgcgagcct       180
     gccacctatg gcaacggcgt gagcatcgcg ctcgcggccg agacgcgggg cgccgtcgat       240
     gccttccatg cggcggcgct ggctgccggc ggtgccgacg agggcgcgcc ggggttgcgg       300
     ccgttccacg cgcattttta tggcgcctgg gtccgcgatc tcgacggcaa caagattgcc       360
     gccgtctgcg agcgcccgga atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page