(data stored in ACNUC7421 zone)

EMBL: CP001389.PE368

CP001389.PE368       Location/Qualifiers
FT   CDS_pept        420401..421549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03760"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24172"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ7"
FT                   /protein_id="ACP24172.1"
FT                   /translation="MRGRRPVDGSGGFVGAKPAIADQKPVIRLTFSVKAATSCLPAHDS
FT                   RGSANQQERSMITQNLKRRTLFGAGAAALAAPGLLTGIANAQESAEKDAMTKDAALKTF
FT                   RLGTFKVTVISDGTRASDNPHETYGTNQPAEAVTALLEQNFLPGSGFINGFSPVLVDTG
FT                   SEIVLFDTGLGEGGRAAGTGKLADGIRAAGYTPEQVSVIVITHMHGDHIGGLTEGGKPA
FT                   FANARYVTGQVEFDFWKDAARVGTPAENGHKAVLAKVAPLAEKTTFIADGVEVVPGIAA
FT                   IAAFGHSPGHMIYRLESEGKALILTADTANHYVLSLQRPDWEVRFDMDKAAASATRRKV
FT                   FDMIATDRLPFIGYHMPFPAVGFVERQDQGYRFVPATYQFDI"
     atgcggggtc ggcgtccggt agacggttcc ggtggctttg tcggggcaaa accggcgatt        60
     gcagatcaaa agcctgtgat ccggctgacc ttttctgtca aggccgctac ttcttgcctg       120
     ccggcgcacg acagtagggg cagcgccaat caacaggagc gatcaatgat cacacagaac       180
     ctgaagcgcc gaaccttgtt cggggcaggg gcggctgcct tggcggcgcc gggcctcttg       240
     accggaattg cgaatgcgca ggaaagtgca gaaaaggacg ccatgaccaa ggatgcggct       300
     ttgaagacgt tcaggctcgg tacctttaag gtgacggtga tcagcgacgg cacgcgcgcc       360
     tcggacaatc cgcacgagac ctacggcacc aatcagccgg cggaagccgt caccgcgctg       420
     ctcgaacaga actttttgcc gggcagcgga ttcatcaacg gcttttcccc ggtcctggtc       480
     gataccgggt cggagatcgt gttgttcgac accgggctcg gcgaaggcgg tcgggcggcc       540
     gggaccggaa aactcgcgga cggcatccgc gccgccggtt acacgcccga gcaggtctcg       600
     gtcatcgtca tcacccacat gcatggcgat catatcggcg gcctcacgga aggcggcaag       660
     ccggccttcg cgaacgcccg ctatgtgacc ggccaagtcg agttcgactt ctggaaggat       720
     gcggcccgcg tcggcacgcc ggccgagaac ggccacaagg cggtgcttgc caaggtcgcg       780
     ccgctggcgg aaaagaccac gttcatcgcc gacggtgtcg aggtcgtgcc ggggatcgcg       840
     gccatcgccg ccttcggcca ttccccggga catatgatct accgcctcga atccgagggc       900
     aaggcgctga tcctgaccgc ggatacggcc aaccactacg tcctgtcgct gcagcggccg       960
     gattgggagg tccgcttcga catggacaag gccgcggcga gcgcgacacg gcgcaaggtc      1020
     ttcgacatga tcgcaaccga tcggctgccc ttcatcggct atcacatgcc gttcccggcc      1080
     gtcggcttcg tcgagcggca ggaccagggt taccgcttcg tgccggcgac ctaccagttc      1140
     gacatctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page