(data stored in ACNUC7421 zone)

EMBL: CP001389.PE37

CP001389.PE37        Location/Qualifiers
FT   CDS_pept        39885..40451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00370"
FT                   /product="putative scaffold protein Nfu/NifU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23841"
FT                   /db_xref="GOA:C3MF04"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF04"
FT                   /protein_id="ACP23841.1"
FT                   /translation="MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEARTGSPLAAR
FT                   LFSIPGVSGVYFGYDFITVSKEGQEWQHLKPAVLGSIMEHFMSGQPIMSGASRAEETDQ
FT                   EGEFYDEGDEAIVATIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSS
FT                   TATLRHGVQNLLRHFVPEVESVESV"
     atgttcatcc agaccgaagc cacgccgaat ccggccactt tgaagttcct gccgggtaag        60
     gtggtcatgg agaacggtac cgccgaattc cgaagcgaag aagaggcgcg caccggctcg       120
     ccgctcgcgg cccggctctt ttctatcccc ggcgtcagcg gcgtctattt cggctacgac       180
     ttcatcacgg tcagcaagga agggcaggaa tggcagcacc tgaagcccgc tgtccttggc       240
     tcgatcatgg aacatttcat gtcaggccag ccgatcatgt cgggagccag ccgagccgaa       300
     gaaacggatc aggaaggcga attctatgac gagggcgacg aggcgattgt cgcgacgatc       360
     aaggagctgc ttgacacgcg ggtgcggccg gccgtcgccc aggatggcgg cgacatcacc       420
     ttccggggtt tcaaggacgg caccgtgttc ctgaacatga agggggcgtg ctccggctgc       480
     ccgtcttcga ccgcaacgct tcggcacggc gtgcagaatc tgctgcgcca tttcgtgcct       540
     gaggtcgaat cggtcgaatc ggtctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page