(data stored in ACNUC7421 zone)

EMBL: CP001389.PE371

CP001389.PE371       Location/Qualifiers
FT   CDS_pept        423828..424910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03790"
FT                   /product="alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24175"
FT                   /db_xref="GOA:C3MGR0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR0"
FT                   /protein_id="ACP24175.1"
FT                   /translation="MWRAPPLDFLRRPSEEEIDMTGTMKAAVVREFGKPLVIEELPIPQ
FT                   PGPGQVLIKYEATGVCHTDLHAAKGDWPVRPNPPFIPGHEGVGYVAKLGAGVTRLKEGD
FT                   RVGVPWLHTACGCCTPCRTGWETLCGSQQNTGYSVDGTFAQYGLADPDFVGTLPAKLEF
FT                   GPAAPVLCAGVTVYKGLKETEVRPGEWVLVSGIGGLGHMAVQYAKAMGMHVAAADIFPD
FT                   KLALAEKLGADLVVDAKAADAIEEVQKRTGGVHGALVTAVSPKAMEQAYRMLRSKGTMA
FT                   LVGLPPSQICLPVFDTVLKRITVRGSIVGTRQDLEEALEFAGEGKVGAHFSWDKIENIN
FT                   AIFERMEEGKIDGRIVLDLN"
     ttgtggcgcg caccgccgct agacttcctt cgtcgaccat cggaggagga gatcgatatg        60
     accggaacaa tgaaagccgc cgtcgtgcgc gagttcggca agccgctcgt gatcgaggaa       120
     ttgccgatac cgcagccggg accggggcag gtcctcatca aatacgaggc cacgggcgtg       180
     tgccacaccg acctgcacgc tgcaaagggc gactggccgg tgaggcccaa tccgcccttc       240
     attcccggcc acgaaggggt cggctacgtc gccaagctcg gcgccggcgt gacgcggctg       300
     aaggagggcg atcgggtcgg ggtgccatgg ctgcataccg cctgcggctg ctgcacgcca       360
     tgccgcaccg gctgggagac gctgtgcggc agccagcaga acaccggcta ttcggtcgac       420
     ggcaccttcg cccaatacgg cctggcggat ccggatttcg tcggcacgct gcccgccaag       480
     ctggagttcg gcccggccgc gccggtactt tgcgccggcg tcaccgtcta caagggcctg       540
     aaggagacgg aggtgagacc cggcgaatgg gtgctcgtct ccggcatcgg cggactcggc       600
     cacatggccg tgcaatatgc caaggccatg ggcatgcatg tcgccgcggc cgacatcttc       660
     cccgacaagc tggcgctcgc cgagaagctc ggcgccgacc ttgtcgtcga tgcaaaggcg       720
     gcggacgcta tcgaggaggt gcaaaagcgg accggcggtg tccacggggc gcttgtcacg       780
     gcggtctcgc caaaggcgat ggagcaggcc taccgtatgc tgcgttcgaa gggcaccatg       840
     gccctcgtcg gtttgccgcc gagccagatc tgcctgcccg tcttcgacac ggtgctgaag       900
     cgcatcacgg tgcgcggctc gatcgtcggc acccgccagg atctggagga ggcgttggaa       960
     tttgccggcg agggcaaggt cggggctcac ttctcctggg acaagatcga aaacatcaac      1020
     gccatcttcg agcgcatgga agaaggcaag atcgacggtc gcatcgttct cgatctgaac      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page