(data stored in ACNUC7421 zone)

EMBL: CP001389.PE372

CP001389.PE372       Location/Qualifiers
FT   CDS_pept        425034..425909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03800"
FT                   /product="putative dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24176"
FT                   /db_xref="GOA:C3MGR1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR1"
FT                   /protein_id="ACP24176.1"
FT                   /translation="MNKPVITQAMIDAYDEYTHLTLDRRRFMERLTALAGTAAAAAAIA
FT                   PLLAANSAKAEMVAATDERIKGEDITYPGADGEMKGYLVKPANASGKLPAVIVIHENRG
FT                   LNPHIKDVARRVALDGFVALAPDFLSPDGGTPEDEDKAREMISALDAGETNANAVATVA
FT                   FLKGHAESTGNVGAIGFCWGGGMVNRLAVNSPDLKAGVAYYGSQPKAEDVPKIKAAMLL
FT                   HYAGLDERINAGIDAYRKALTENGKDATIYVYDGVNHAFNNDTSAARYDKAAAELAWGR
FT                   TVEFLKTKLA"
     atgaacaagc ctgtgatcac tcaggcaatg atcgatgcct atgacgaata cacgcatctg        60
     accctggatc gccgccgctt catggagagg ctgacggcgc tcgccggcac ggcggcggcc       120
     gccgcggcaa tcgccccttt gctcgccgcc aacagcgcca aggccgaaat ggtcgccgcg       180
     acggacgaac ggatcaaggg ggaggacatc acctatccgg gtgccgacgg cgagatgaag       240
     ggctatctgg tcaagcccgc caatgcatcc ggcaagcttc cggcggtgat cgtcatccac       300
     gagaaccgcg gcctcaatcc gcatatcaag gacgtcgcgc gtcgcgtcgc gctcgacgga       360
     ttcgtcgccc tcgctcccga tttcctgtcg cccgatggcg gcacgcctga agacgaggac       420
     aaggcgcgcg agatgatcag cgcgctcgac gccggtgaaa ccaacgccaa tgcggtcgcc       480
     accgtcgcct tcctcaaggg tcatgcggaa agcaccggca atgtcggcgc gatcggcttt       540
     tgctggggtg gcggcatggt caatcgtctt gcggtcaatt ctcccgatct gaaggccggc       600
     gtcgcctatt acggctccca gccgaaggcc gaggacgtgc cgaagatcaa ggccgccatg       660
     ctgctccact atgcggggct cgacgagcgc atcaatgccg gcatcgatgc ttaccgcaag       720
     gcactgacgg agaacggcaa ggacgccacg atctatgtct atgacggcgt caaccatgcc       780
     ttcaacaacg atacttcggc cgcccgctac gacaaggcgg cagccgaact cgcctgggga       840
     cggaccgtcg agttcctgaa gacaaaactt gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page