(data stored in ACNUC7421 zone)

EMBL: CP001389.PE375

CP001389.PE375       Location/Qualifiers
FT   CDS_pept        428188..428484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24179"
FT                   /db_xref="GOA:C3MGR4"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR4"
FT                   /protein_id="ACP24179.1"
FT                   /translation="MRTTQHALDLDLAAGKPSLASRTAGVIGVLTAVWRLYRSRCQIAR
FT                   LHDLDDRQLLDMGLKREDLHEAMTSSFFENPGSFLTRASRNRANHFYRGVRHD"
     atgcgcacga cccaacacgc cctcgatctc gacctcgctg caggcaagcc gtcgcttgcg        60
     tcccgcacgg caggtgtcat cggcgtgctg acggctgtct ggcgcctgta ccgaagccgc       120
     tgccagattg cgcgtctcca cgatctcgac gatcggcaac tgctcgacat ggggttgaaa       180
     cgcgaagacc tgcacgaggc catgacctcg tccttcttcg agaacccggg cagcttcctg       240
     acgcgcgcat cgcgaaaccg ggcgaaccac ttctacaggg gtgtccgcca cgattga          297
//

If you have problems or comments...

PBIL Back to PBIL home page