(data stored in ACNUC7421 zone)

EMBL: CP001389.PE376

CP001389.PE376       Location/Qualifiers
FT   CDS_pept        complement(428857..429675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24180"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR5"
FT                   /protein_id="ACP24180.1"
FT                   /translation="MAPLFDMFAQAQNGQAIELMAKQFGLAQDQMAKATAALMPAFSTG
FT                   FKRNTANPYDFGALLTALSTGNYVKYFEDMRQAFTPEGVSDGNDILGQLFGSKEMSRAV
FT                   AAQAAQMTGIGQEVYKQMLPVMASTLMGGLFKETTNQVNEALASNPMMTLMRQWMEATG
FT                   LAKKPEPAPNPFENPFTQAMQGFFGAGRSQETPKTPDFFAGNPFFKAYQDMMRGSSAAT
FT                   EKPPQENPAFAQFSQMMNNMFDTGLGMQKEYQKNIDALFESYKSGSGGKG"
     atggcaccgc tttttgacat gttcgcacaa gcgcagaatg gccaggcgat cgagctgatg        60
     gcaaagcagt tcggcctggc ccaggaccag atggcgaagg cgacagcggc gctgatgccg       120
     gccttttcca cgggcttcaa gcgcaacacc gccaatccct atgacttcgg tgcgctgctg       180
     acggccctct cgaccggcaa ttacgtgaaa tatttcgagg atatgaggca ggccttcacg       240
     cctgagggcg tgtctgacgg caacgatatc ctcggtcagt tgttcggctc gaaggagatg       300
     tcgagggcgg tcgcggcaca ggcggcacag atgaccggca tcggccagga agtctacaag       360
     cagatgctgc cggtgatggc gagcacgctg atgggcggcc tcttcaagga gaccaccaac       420
     caggtgaacg aagcgctcgc cagcaatccg atgatgacgc tgatgcggca atggatggag       480
     gcgaccggtc tcgccaagaa gcccgagcct gcgcccaacc cgttcgagaa tcccttcacc       540
     caggcgatgc agggattctt cggtgcgggc aggagccagg agacaccgaa aacgcctgat       600
     tttttcgccg gcaatccctt cttcaaggcc taccaggaca tgatgcgcgg cagcagtgcg       660
     gcgaccgaga agccgcctca ggaaaacccc gccttcgcgc agttctccca gatgatgaac       720
     aacatgttcg acaccggcct ggggatgcag aaggaatatc agaagaacat cgacgcgctg       780
     tttgagagct acaagagtgg ttccggcggc aagggttag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page