(data stored in ACNUC7421 zone)

EMBL: CP001389.PE377

CP001389.PE377       Location/Qualifiers
FT   CDS_pept        complement(429776..431149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03850"
FT                   /product="glutamate-cysteine ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24181"
FT                   /db_xref="GOA:C3MGR6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR6"
FT                   /protein_id="ACP24181.1"
FT                   /translation="MARDTTDQTPVTSVAELTAYLASGSKPKERFRIGTEHEKFAFFKA
FT                   DNSPVPYFGEASIQALLKGMAERNGWEPIVDEGNIIGLAERDGNGAISLEPGGQFELSG
FT                   APLENLHQTCKESNQHLAVLREIAEPLGIRFLGIGGSPKWTFEETPRMPKSRYAIMSRY
FT                   MPKVGTHGLDMMYRTCTIQVNLDFSSEEDMRRKMQVSMKLQSLATALFASSPFTDGKPN
FT                   GLLSWRGEIWRDTDNRRAGLLPASFRPDFGFADYVEWALDVPMYFVVRDGHYHDCTHVT
FT                   FRQFMNGALKGEIAEWQPNMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDQALADAETLTRDWSYDEVQALRDAVPAEGLAAKFRTTSLFDIAREVLAISR
FT                   AGLKRRNRLNGDGIDESQFLEPLGEVLAKKATLAEDLLALYDGRWNRSVDPVFTEYQY"
     atggcccgag acaccaccga ccagacgccg gtcacctccg ttgccgaact gaccgcctac        60
     ctcgcgtccg gatcgaagcc gaaagagagg ttccggatcg ggacggagca cgagaaattc       120
     gccttcttca aagccgacaa cagccccgtt ccctatttcg gcgaagccag catccaggcg       180
     ctcttgaaag gcatggccga gcggaatggc tgggagccga tcgtcgacga gggcaatatc       240
     atcggcctgg ccgaacggga cggcaacggc gcgatctcgc tggagcccgg cggccagttc       300
     gagctttccg gagcgccgct cgagaacctg catcagacct gcaaggaatc gaaccagcac       360
     ctggccgtgc tccgcgagat cgccgagccg ctcggcatcc gcttcctcgg catcggcggc       420
     agcccgaaat ggaccttcga agaaacgccg cgcatgccga aatcgcgcta cgcgatcatg       480
     tcgcgctaca tgccgaaggt cgggactcac ggcctcgaca tgatgtaccg cacgtgcacg       540
     atccaggtga atctcgactt ctcctccgag gaggacatgc ggcgcaagat gcaggtatcg       600
     atgaaactgc aatcgctcgc cactgccctc ttcgccagct cgcctttcac cgacggcaag       660
     ccgaacggcc tgctctcgtg gcggggagag atctggcgcg acaccgacaa ccgacgcgcg       720
     ggtctcctgc cggcctcctt caggccggac ttcggctttg ccgactacgt cgaatgggcg       780
     ctcgacgtgc cgatgtattt cgtcgtgcgc gacggccatt atcatgactg cacccatgtc       840
     accttccgcc agttcatgaa cggggcgctg aagggagaga tcgccgaatg gcagcccaac       900
     atgggcgact ggaccaatca tctctcgact ctcttccccg acgtccggct gaagcgcttc       960
     cttgagatgc gcggcgccga cggcggaccg tggcggcgga tctgcgcgct gcccgccttc      1020
     tgggtcggcc tgctctacga cgaccaggcg ttggcggatg ccgagacgtt gacccgcgac      1080
     tggagctacg acgaggtcca agcactccgg gacgcagttc ccgccgaggg gctggccgcg      1140
     aagttcagga caacctcgct gttcgacatc gcccgcgagg tgctggcgat ttcacgcgcc      1200
     gggttgaaac ggcgcaaccg tctgaacggc gatggtatcg acgagagcca gttcctggaa      1260
     ccgctcggcg aagttctggc gaagaaggcg acgctcgccg aggatctgct ggccctctac      1320
     gacggccgct ggaaccggtc cgtcgacccg gtgtttacgg aataccaata ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page