(data stored in ACNUC7421 zone)

EMBL: CP001389.PE378

CP001389.PE378       Location/Qualifiers
FT   CDS_pept        complement(431334..432071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24182"
FT                   /db_xref="GOA:C3MGR7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR7"
FT                   /protein_id="ACP24182.1"
FT                   /translation="MRANFRMQRLFVESPLHAGARHEATKDQFNYLINVLRFGEGSSIL
FT                   VFNGRDGEWRAELSLPSRKQLVLTAVEQTRPQPAPSDLVYLFAPLKTGRLDYLVQKAVE
FT                   MGAGVLQPVMTQHVQGKLGNLDRLRANVTEAAEQCGVLGIPSVETPRKLEELLANWPRE
FT                   RRIIFCDEGNESQNPLPILGGISERRLALLIGPEGGFSEAERVLLHSLDFVTAVPLGPR
FT                   ILRADTAAVAALALIQATLGDWR"
     atgcgcgcca atttccgcat gcagcgattg ttcgtcgaaa gcccgcttca cgccggggca        60
     aggcacgagg cgacgaagga tcagttcaac tatctcatca acgtgctgcg cttcggcgag       120
     ggttcgtcga tcctggtctt caatggacga gacggcgaat ggcgtgcgga attgtctctt       180
     ccttcccgaa agcagctggt gctcacggca gtcgagcaga cccgtccgca gccggctccc       240
     tcagacctcg tctatctgtt tgccccgctc aagactgggc ggctcgacta cctcgttcag       300
     aaggccgtcg agatgggcgc cggcgtgctg cagccggtga tgacccagca tgtgcaaggc       360
     aagctcggca atctcgaccg cctgcgcgcc aatgtcaccg aggccgcgga gcaatgcggg       420
     gttctcggca ttccctcggt ggagacgccc cgaaaactcg aagaactgct ggcgaactgg       480
     ccgcgcgagc ggcgcatcat cttctgcgac gagggcaatg agagccagaa tccgctgccg       540
     atcctcggcg ggatcagcga gcgccgcctc gccctgctga tcggcccgga aggaggcttc       600
     tcggaagccg agcgggtgct cttgcacagc ctcgatttcg tcaccgcagt cccgctcggt       660
     ccacgcatcc tgcgcgccga tacggcggcg gtggccgcgc tggcactcat tcaggcaacg       720
     ctcggcgact ggcggtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page