(data stored in ACNUC7421 zone)

EMBL: CP001389.PE379

CP001389.PE379       Location/Qualifiers
FT   CDS_pept        complement(432082..433590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03870"
FT                   /product="putative phosphate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24183"
FT                   /db_xref="GOA:C3MGR8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR8"
FT                   /protein_id="ACP24183.1"
FT                   /translation="MSKPRLRLEKLTIDKDLDKVSRAEEASQHVMRGLAAPGLGLLFLI
FT                   LSMAFAASYFTGASGMAIVVAGAAIAAYMAMNIGANDVTNNVGAAVGAKAMTMATALGI
FT                   AAVFEIAGAVIAGRKVTLTIEAGIVDGAQLVSLDVLVWVMMAALLSSAVWINIATYARA
FT                   PVSTTHSIVGGIIGAGMAAEGFASVKWWAIAGITASWSVSPLLGGAIAALFLAFLKEFV
FT                   IYRNDKIAAARYWMPIVLGVTAGSFTAYVAVSALVHLQVISLGTGLLIGTLAGIACYGL
FT                   CKPWIHRQSAGLENRNQSLRKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVSAVNG
FT                   TISTARSEAPFWVLLIGALGISMGLLLYGPILIRVVGEEITRLNPMRAFCVALATAVTV
FT                   LLASALGLPISSTHTAVGAVFGVGFFREWYIRHSRRRLEYIRRRTGQTGFMGEAIETNF
FT                   AEVRRRRLVRRSYFLTIVAAWVITLPASALLSALVYRLLAGLFL"
     gtgtccaagc cgcgactgcg cctcgaaaag ctgacgatcg acaaggatct cgacaaggtc        60
     agccgtgccg aggaagcgtc gcaacatgtg atgcgcgggc ttgccgcccc gggcctcggc       120
     ctgctctttc tgatcctcag catggcattc gcagccagct atttcacggg cgcgtccggc       180
     atggccatcg tcgtggcggg ggccgcaatt gccgcctaca tggcgatgaa catcggcgca       240
     aacgacgtca ccaacaatgt cggagccgcg gtcggcgcca aggccatgac gatggcgacg       300
     gcgcttggca ttgccgccgt cttcgaaatt gccggagccg tgattgccgg gcgaaaggtg       360
     acgcttacca tcgaggccgg catcgtcgac ggcgcgcaac tggtcagcct cgacgttctc       420
     gtctgggtga tgatggcggc gctcttgtct tcggccgtct ggatcaacat cgccacatac       480
     gcgcgcgccc cggtctcgac aacccactcc atcgtcggcg gcatcatcgg cgccggcatg       540
     gcggccgagg gcttcgccag cgtcaaatgg tgggcgatcg ccgggatcac cgcgagctgg       600
     tcggtctctc ccctgctcgg cggcgcgatt gccgccctgt tcctggcatt tctcaaggaa       660
     ttcgtcatct accgcaacga caagatcgcg gcggcgcgct actggatgcc gatcgtgctc       720
     ggcgtcacgg caggctcttt caccgcctat gtggcggtct ccgcgctcgt ccatctgcag       780
     gtgatttcgc tggggacggg ccttctcatc ggcacccttg ccggcattgc gtgctacggg       840
     ctgtgcaagc cgtggattca tcgccaatcg gcgggactcg aaaaccgcaa ccagtcgctt       900
     cgcaagctgt tccgcctgcc gctcatcttc tccgccgcgc tgctctcctt cgcgcacggc       960
     gccaatgacg tgtcgaacgc catcggaccg ctgtcggcga tcgtctcggc cgtgaacggc      1020
     acgatttcga cggcgcggtc ggaggcaccc ttctgggtgc tgctcatcgg cgctctcggc      1080
     atctcgatgg gcctgcttct ctacgggccg atcctgatcc gcgtcgtcgg cgaggaaatc      1140
     acccgcctca atccgatgcg cgccttctgc gtggcgctgg cgacggcggt caccgtcctc      1200
     ctggcatcgg cgctggggct gccgatcagt tccacgcaca cggcggtcgg tgccgtcttc      1260
     ggcgtcggtt ttttccgcga atggtacata cgccattcgc ggcgacggct ggagtatatc      1320
     cggcggagga ccggccaaac cggcttcatg ggcgaggcca tcgaaacgaa tttcgccgag      1380
     gtacgccgcc gccggctggt gcgccgctcc tatttcctga cgatcgtcgc cgcctgggtg      1440
     atcacgcttc ctgcctcggc gctgctctcg gcgctcgtct accggctgct tgccggcctg      1500
     tttctgtga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page