(data stored in ACNUC7421 zone)

EMBL: CP001389.PE380

CP001389.PE380       Location/Qualifiers
FT   CDS_pept        complement(433802..434308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03880"
FT                   /product="putative NTP pyrophosphohydrolase protein,
FT                   MuT/nudix family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24184"
FT                   /db_xref="GOA:C3MGR9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR9"
FT                   /protein_id="ACP24184.1"
FT                   /translation="MNFLHRLASDVHLMMRRPARMQYAALCYRIRKKTVSPEILLLTSR
FT                   DTGRWVIPKGWPMQGKWAHEVAEREAYEEAGVKGKAQKAAIGSYVYQKRMDHGLKIPCK
FT                   VQVHALEVDNLCKNFPEKGERKLEWVDYAEAARRVAEPSLKELILGFGKRMAAAQPPEP
FT                   AASEG"
     ttgaacttct tgcaccggct agcttctgac gtgcatttga tgatgcgtcg accggcgcgc        60
     atgcaatatg ccgcgctgtg ctaccgcatc cgcaagaaaa cggtgtctcc ggaaatcctc       120
     ctgctcacca gccgtgacac gggccgctgg gtcattccca agggatggcc gatgcaggga       180
     aagtgggccc atgaggtcgc cgaacgcgag gcctatgaag aggccggcgt gaaaggcaag       240
     gcgcagaagg ctgcgatcgg ctcctatgtc tatcagaagc gcatggacca cgggttgaag       300
     attccctgca aagttcaggt ccacgccctc gaagttgaca atctctgcaa aaattttccc       360
     gagaagggcg agcgaaagct cgagtgggtc gactacgcgg aggccgcccg gcgtgtcgcc       420
     gagccttcgc tgaaagaact gatcctcggt ttcggcaagc gaatggccgc cgcccagccg       480
     ccggagcccg cggcctccga aggctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page