(data stored in ACNUC7421 zone)

EMBL: CP001389.PE382

CP001389.PE382       Location/Qualifiers
FT   CDS_pept        435564..436838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24186"
FT                   /db_xref="GOA:C3MGS1"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS1"
FT                   /protein_id="ACP24186.1"
FT                   /translation="MAKASFGFPAAPLRAQVLGEIHSRPYALVTTPRVIFQLAFITEGG
FT                   SIVDHAVLSELSRSRGIAPPSRDANHHAMAWGQGTLRWERHTEFSTYFWDAPAPEQFGG
FT                   EVPIHPFGDGFSPPGLLISGIRLEIRPDTPEAREAIKAFDPTSLCYSETKNGQAVLLTD
FT                   FRQNGDGLTQILILDRGMTEAGTGALVQRLLDIETYRTLAMLGLPLAQSLSPEIRRTED
FT                   GLTGVTQRMKENVREEADEMLAEITRLAAELEAGAALSLYRFGASRAYYGIVQERIRTL
FT                   SETPVPGYETIGTFLERRLAPALRTCQSVEERQANLSRKLSRATALLRSWIDVELERQN
FT                   SALLNSMDRRAKLQLRLQQTVEGLSVAAISYYVIGLFGYLAKAVSHELPVDPGVLTGLA
FT                   VPFAVVGVWLVVRRIRRHHEESAHK"
     atggcgaagg caagttttgg atttcctgca gcgcccttgc gcgcccaggt actcggagaa        60
     attcactccc ggccctatgc gctggtaacg acgccgcgcg tcatctttca gctcgccttc       120
     attaccgaag gcggttcgat cgttgaccat gcggtgcttt cggaattgtc ccgctcgcgc       180
     ggcatcgcgc cgcccagtcg cgatgccaac caccacgcca tggcgtgggg gcaggggacg       240
     ttgcgctggg agcggcacac cgaattttcc acctatttct gggacgcgcc ggcgccggaa       300
     cagttcggcg gcgaggtgcc gatccatcct ttcggcgacg gattctctcc gccgggtctg       360
     ctgatttccg gtatccgcct tgaaatccgt ccggatacgc cggaagcccg cgaggcgatc       420
     aaggccttcg atccgacgag tctctgttac agcgagacca agaacggcca ggccgtgctg       480
     ctgaccgact tccggcagaa cggcgacggt ctcacccaga tcctcatcct cgaccggggc       540
     atgacggagg ccggcacggg tgcgctggtc cagcgtctgc tcgacatcga gacctaccgg       600
     acgctcgcca tgctcggtct gccgctggcg cagtcgctgt cgccggaaat ccgccggacc       660
     gaggatggcc tgaccggcgt cacccaacgc atgaaggaga atgtccgcga ggaagcggac       720
     gaaatgctgg cggagatcac ccggctcgcc gccgagcttg aggccggtgc tgcgctcagc       780
     ctctatcgct tcggcgcgag ccgcgcctat tacggcatcg tccaggagcg catccgaaca       840
     ctctccgaaa caccggtgcc cgggtacgag acgatcggaa ccttcctcga acgcaggctg       900
     gcgccggcgc tgcgcacctg ccagtcggtc gaggagcggc aggccaatct gtcgcgcaag       960
     ctctcccgtg caacggcgct gctcagaagc tggatcgatg tcgaactcga acggcagaac      1020
     agcgcgctgc tcaattcgat ggaccgccgt gcgaaactgc aattgcgcct gcagcagacc      1080
     gtcgagggtc tctccgtcgc ggcgatctcc tattacgtca tcggcctgtt cggttatctc      1140
     gccaaagcgg taagccacga gcttccggtc gatcccggcg tgctgaccgg ccttgccgtg      1200
     ccctttgcgg tcgttggcgt ctggctggtc gttcgccgca ttcgccgcca ccacgaggaa      1260
     agtgcgcata aatag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page