(data stored in ACNUC7421 zone)

EMBL: CP001389.PE383

CP001389.PE383       Location/Qualifiers
FT   CDS_pept        complement(436862..437758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03910"
FT                   /product="putative transcriptional regulator protein, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24187"
FT                   /db_xref="GOA:C3MGS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS2"
FT                   /protein_id="ACP24187.1"
FT                   /translation="MTNLGDLEVFARVVSTGSMSAAGRALGLSAAVISKRVKRLEERLG
FT                   TRLLQRTTRQVSLTEAGQGFYDRVLGVLAGIEEAEAYAAGRSSQAQGTLRITAPTSFGR
FT                   MHIAPHLTGFMKDHPDLKLHIVLSDEFSDIVADGFDLAVRIGELTDSSLVARKLAPVRR
FT                   LLCASPDYISRHGAPKEIGDLAEHICLPAHNNESWKLEGPGGSLAYRPDGPLVTNSSEI
FT                   IRAAVIAGAGIALRSTWDVSAELRDGHLVQVLPEWEGSQRLTLSAVYPSRQFLPAKVRL
FT                   FVDYLSALYGPVPYWEQ"
     atgacgaatc ttggggatct cgaagtgttc gcgcgcgtgg tttccaccgg tagcatgtcg        60
     gcggcgggcc gcgccctcgg cctttccgcg gcggtaatct ccaagcgcgt caagcggctc       120
     gaggagaggc tcggcacgcg tcttctgcag cgcacgacac gccaggtctc cctgacggag       180
     gccggacagg gcttctacga ccgcgtcctg ggcgtcctcg ccggtatcga ggaggcggag       240
     gcctatgccg cgggccggtc gtcgcaggcc caggggacgt tgcgcatcac ggcacccacc       300
     tccttcggcc gcatgcatat cgcgccgcac ctgaccggct tcatgaagga tcaccccgac       360
     ctgaagctcc atatcgtcct cagcgacgag ttcagcgaca ttgtcgccga tggcttcgac       420
     ctggccgtcc ggatcggcga gcttaccgat tcgagtctgg tcgcccgcaa gctcgcgccg       480
     gtccgccgct tgctctgcgc atcacccgac tacatttccc ggcacggtgc tcccaaggag       540
     atcggcgacc tcgccgaaca catctgcctg ccggcccaca acaacgaaag ctggaagctg       600
     gaaggtccgg gcgggtcctt ggcttaccgt ccggacggcc cgctcgtcac caattcgtcg       660
     gagatcatcc gcgccgcagt gatcgccgga gcggggatcg cgctccgctc gacctgggac       720
     gtcagtgcgg aactgcgcga cgggcacctg gtacaggtgc tgccggaatg ggaaggatca       780
     caaaggctga cgctctcggc cgtctatccg agccggcagt tccttcccgc caaggtccgg       840
     ctcttcgtcg attatctctc agccctctat ggccccgtcc cctattggga gcagtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page