(data stored in ACNUC7421 zone)

EMBL: CP001389.PE386

CP001389.PE386       Location/Qualifiers
FT   CDS_pept        440918..441298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24190"
FT                   /db_xref="GOA:C3MGS5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS5"
FT                   /protein_id="ACP24190.1"
FT                   /translation="MPDPGPQTPLSRDTDRWLEPGKVNIQIIYLLYLVGFAIGVTVLVG
FT                   IVLAYLNRDKAEPWARTHYTWAIRTFWIALLFAVVSALLSVLLIGVLGFIATAVWIVVR
FT                   CVIGLQKAAREEPITDPESWLV"
     atgcccgatc ctggtccgca gacgccgctt tcccgcgaca ccgatcgctg gctggagccg        60
     ggcaaggtca acatccagat catctacctg ctctatctcg tcggcttcgc gatcggcgtc       120
     acggtactgg tcggcatcgt gctcgcctat ctcaaccggg acaaagccga gccgtgggcg       180
     aggacccact acacctgggc gatccgcacc ttctggatcg cgttgctgtt cgcggtcgtc       240
     tcggcgcttc tgtccgtatt gctcattggt gtgctcggct tcatagcgac ggcggtctgg       300
     atcgtcgtgc gctgtgtcat cgggcttcag aaggcggctc gcgaggagcc gatcaccgac       360
     cccgaaagct ggctcgttta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page