(data stored in ACNUC7421 zone)

EMBL: CP001389.PE387

CP001389.PE387       Location/Qualifiers
FT   CDS_pept        441360..442655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03950"
FT                   /product="glycolate oxidase, iron-sulphur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24191"
FT                   /db_xref="GOA:C3MGS6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS6"
FT                   /protein_id="ACP24191.1"
FT                   /translation="MQTNFSREQLADPHVAESEKILRKCVHCGFCTATCPTYVLLGDEL
FT                   DSPRGRIYLIKDMLENGRAADAETVTHIDRCLSCLSCMTTCPSGVDYMHLVDHARVHIE
FT                   KTYKRPLKDRFARSVIAATLPYPSRFRLALRAARLARPLAGLLKRVAWLRTFGVMLDLA
FT                   PRAMPTASDGARAAVYAAKGTPRGRVALLTGCAQPVLRPEINEATVRLLTGQGVEVVVS
FT                   AGEGCCGALVHHMGREEQALDAARRNVDVWLKAADEDGLDAIVITASGCGTTIKDYGHM
FT                   LRLDPAYAEKAAKVSALAKDITEYLAGLDLPEQGARGMTVAYHSACSMQHGQKITLAPK
FT                   QLLKRAGFAVREPAEGHLCCGSAGTYNILQPEISAKLKARKVRNIEATKPNVIATGNIG
FT                   CITQIAGGTNIPILHTVELLDWAYGGPKPAGL"
     ttgcagacaa atttctctag agagcaactc gccgacccgc atgtcgcaga atcggaaaag        60
     atcctgcgca aatgcgtcca ttgcggcttc tgcacggcca cctgtccgac ctatgttctg       120
     cttggcgacg agctcgacag tccgcgcggg cggatctacc tcatcaagga catgctggaa       180
     aacgggcgtg cggccgatgc cgaaaccgtc acgcatatcg accgatgtct ctcctgcctt       240
     tcctgcatga ccacctgccc gtcgggcgtc gattacatgc atctggtcga tcatgcccgt       300
     gtccacatcg agaagaccta caagcgaccg ctcaaggacc gttttgcccg ctccgtcatc       360
     gccgcgacct tgccctatcc ttcgcgcttc cggctggcgc tccgggcggc gaggcttgcg       420
     cggcccttgg cgggcctgct gaagcgggtt gcctggctca ggaccttcgg cgtcatgctc       480
     gacctcgcac cccgcgcgat gcccacggcg tcggatgggg cgagggcagc cgtttacgcc       540
     gccaagggca caccacgcgg ccgtgtcgcg ctgcttaccg gatgcgcgca gccggtattg       600
     aggccggaga tcaacgaggc aaccgtccgg ctgctcaccg ggcagggcgt agaggtcgtc       660
     gtttcagcgg gcgagggctg ctgcggcgcg ctggtccatc acatggggcg cgaggagcag       720
     gcgctggatg ccgcccggcg caacgtcgat gtctggctga aggctgccga cgaggatggt       780
     ctcgacgcga tcgtcatcac cgcgtccggc tgcggcacga cgatcaagga ttatggccac       840
     atgctgcggc tggatccggc ctatgccgag aaggcggcga aggtttccgc acttgccaag       900
     gacataaccg aatatctggc gggactggac ctgcccgagc agggcgcgcg cggcatgacc       960
     gtcgcctatc actccgcctg ctcgatgcag cacgggcaga agatcaccct ggcgccgaag      1020
     cagcttctga agcgcgcggg ctttgcggtt cgcgaaccgg ccgaaggcca tctctgttgc      1080
     ggctcggcag gaacctacaa catcctgcag ccggagatat cggcgaagct gaaagcgcga      1140
     aaagtccgca acatcgaggc gacaaagccg aacgtgatcg ccacaggcaa tatcggctgc      1200
     atcacccaaa ttgccggcgg cacgaatatt ccgatcctgc ataccgtcga actgctcgac      1260
     tgggcctatg gtgggccgaa accggcgggg ctgtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page