(data stored in ACNUC7421 zone)

EMBL: CP001389.PE39

CP001389.PE39        Location/Qualifiers
FT   CDS_pept        41673..42170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00390"
FT                   /product="predicted ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23843"
FT                   /db_xref="GOA:C3MF06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF06"
FT                   /protein_id="ACP23843.1"
FT                   /translation="MSFTDYFTRRTEFDIFPLEEIDLLAAAALHSQRFATPWSDGEIHA
FT                   LLLQDAVFGFAARQTNGAFRPALGGFVLSRAAAGEAEILTIGVDSRFARSGLGWRLMQA
FT                   AMREAIVKGAETLFLEVDETNLAAIGLYGKLGFARVGERKAYYKGTAGARTAALVMRLD
FT                   LR"
     atgagcttca cggactattt cacacgccgc actgaattcg acatctttcc gctggaggag        60
     atcgatctcc tggcggcggc tgctctgcac agccagcgtt tcgcgacacc gtggagcgac       120
     ggcgagattc acgcgctcct gttgcaggac gcggtcttcg gcttcgccgc ccgccagacg       180
     aacggcgcct ttcgtccggc actcggaggc ttcgtgctgt cgcgtgccgc cgcgggcgag       240
     gccgagatcc tgacgatcgg tgtcgattcg cgcttcgccc gctccgggct tggctggcgg       300
     ctgatgcagg ccgcgatgcg cgaggcgatc gtcaagggcg ccgagacgct gttcctcgaa       360
     gtcgacgaga cgaacctggc ggcgatcggt ctctatggca agcttggctt cgcaagggtc       420
     ggcgaacgca aggcctatta caagggcacg gccggggcgc gcaccgctgc gcttgtcatg       480
     cggctcgatc ttcgctag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page