(data stored in ACNUC7421 zone)

EMBL: CP001389.PE391

CP001389.PE391       Location/Qualifiers
FT   CDS_pept        complement(445383..445754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24195"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT0"
FT                   /protein_id="ACP24195.1"
FT                   /translation="MSLKRILTALMIAASIGSPALSQESGHQGMKHDATAAEPAPSSRA
FT                   FAEANAKMHKDMDIDFTGNADVDFVRGMIAHHQGAIDMAKVELEYGKDEAIRKLAETII
FT                   KVQEGEIKMMKEWLAGHGG"
     atgtccctga aaaggatcct cactgctttg atgatcgccg catcgatcgg cagtcccgca        60
     ctttcgcaag agagcggtca tcaaggcatg aaacacgatg caacggcggc cgagccggca       120
     ccatcgagca gggccttcgc cgaagcgaat gccaagatgc acaaggatat ggacatcgac       180
     ttcaccggca atgccgacgt cgacttcgtg cgcggcatga tcgctcacca ccagggcgcg       240
     atcgacatgg cgaaggtcga gctcgaatac ggcaaggacg aggcgatccg caagctcgcg       300
     gaaaccatca tcaaggtcca ggagggagag atcaagatga tgaaggaatg gctcgccggg       360
     cacggcggct ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page