(data stored in ACNUC7421 zone)

EMBL: CP001389.PE392

CP001389.PE392       Location/Qualifiers
FT   CDS_pept        complement(446262..446690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT1"
FT                   /protein_id="ACP24196.1"
FT                   /translation="MLTVMTPGAAAIRPLNPETHGAWTRALAKAGYVIDRWHCDVDSGA
FT                   FVVGLRTLSLLGLRQNPCGIIDLVRAYDQEDRATILSILEQATATSSSFCFSAMVRRPS
FT                   GSAYQLCCIGNSTLGAHGAGGSLQGVFAVPRSRSALPA"
     atgctgactg tcatgacgcc cggggcggca gcgatacgac cgctcaatcc ggaaacccat        60
     ggggcctgga cccgcgcgct cgcgaaggct ggctatgtga tcgaccggtg gcattgcgac       120
     gtggacagcg gcgcctttgt ggtcggccta cggacacttt cgctgcttgg cctgaggcag       180
     aatccctgcg gcatcatcga cctcgtccgg gcctacgacc aggaagaccg agcgacaatc       240
     ctgagcatct tggaacaggc gacagcgacg tcctcgtcct tctgcttttc ggcgatggtc       300
     cgccggccga gcggaagcgc ataccagctt tgctgcatcg gaaactcgac gctcggcgca       360
     catggcgcag gaggttccct gcaaggcgta ttcgccgtgc cccggagtcg atctgcgttg       420
     ccggcttga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page