(data stored in ACNUC7421 zone)

EMBL: CP001389.PE394

CP001389.PE394       Location/Qualifiers
FT   CDS_pept        448487..449626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04020"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24198"
FT                   /db_xref="GOA:C3MGT3"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGT3"
FT                   /protein_id="ACP24198.1"
FT                   /translation="MPLINLPAFAGDLLADFERLKTLRVDTPVIQPAEPFLDMAGEDLR
FT                   RRIFMTQSETGDSLCLRPEFTIPVCLRHIETATGTPQRYAYLGEVFRQRREGSSEFYQA
FT                   GIEDLGDTDTAGADARAIGDAMRVLSNRLANRRLKVTLGDQSVFEAVIAACGLPGGWQK
FT                   RLIHAFGDPKQLQKLLGELADPKSPGVFGHEVERLAILGILDDEERLVAHLAETMEATG
FT                   YSTNASRSPRDIARRLKEKMELATTRLDRAALAVMREFLAFDLPLSEAPAALHAFAKKS
FT                   RLKIDDALSLFDARVAAIAKVGAESDLIRYRAAFGRPLDYYTGLVFEIEAEGAPAVLAG
FT                   GGRFDRLLTLLGAREHIPAVGFSLWLDRIERAIAAAGGA"
     atgccgctga tcaaccttcc tgcctttgcc ggtgaccttc ttgccgactt cgagcggctg        60
     aagacgctgc gcgtcgacac gccggtgatc cagccggccg agccctttct cgacatggcc       120
     ggggaagacc tgcgccggcg gatcttcatg acgcagagcg agaccggcga cagcctctgc       180
     ctgcggccgg aattcaccat ccccgtctgc cttcgccata tcgagacggc aaccgggacg       240
     ccgcagcgtt acgcctatct tggcgaggtc ttccggcagc gccgggaggg ctcgagcgaa       300
     ttctaccagg cgggtatcga ggatctcggc gacaccgata cggctggcgc cgatgcgcgg       360
     gcgatcggcg acgccatgcg cgtgctctcc aaccggcttg ccaatcggcg actcaaggtg       420
     acgcttggcg atcaatcggt cttcgaggcg gtcattgccg cctgcggatt gccgggcggc       480
     tggcagaagc gtttgatcca cgccttcggt gaccccaaac agctgcagaa gctgctcggc       540
     gagctcgccg atcccaagtc ccccggtgtc ttcggccatg aagtcgagcg gcttgccatc       600
     ctgggcatcc tcgacgacga ggagcggctc gtcgcccatc ttgccgagac gatggaggcg       660
     accggctatt ccaccaatgc cagccgttcg ccgcgcgaca tcgcccgtcg gctgaaggaa       720
     aagatggaac tggcgacgac gcggcttgac agggccgccc tcgccgtgat gcgcgaattc       780
     cttgcgttcg acttgccgct ttccgaagca ccggcggcgc tgcacgcttt cgcaaagaaa       840
     tcgagactga agatcgacga cgccctctcg ctcttcgacg cccgcgtcgc ggcgatcgcc       900
     aaggtcggcg ccgagagcga cctcatccgc tatcgagccg ccttcggccg tccgctcgat       960
     tactacaccg gccttgtctt cgagatcgag gctgaaggag cgccggcggt tctggcgggc      1020
     ggcgggcgct tcgatcggct gctgacgctg ctcggcgccc gcgagcatat tccggccgtc      1080
     ggcttctctc tttggctcga ccggatcgaa cgggcgatcg ctgccgcagg gggcgcttaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page