(data stored in ACNUC7421 zone)

EMBL: CP001389.PE397

CP001389.PE397       Location/Qualifiers
FT   CDS_pept        451287..452504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04050"
FT                   /product="putative ferredoxin reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24201"
FT                   /db_xref="GOA:C3MGT6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT6"
FT                   /protein_id="ACP24201.1"
FT                   /translation="MSGRLVVIGGGQAAFALVAKLRALQDTRPITVIAAESSLPYQRPP
FT                   LSKKYLLREMTLDRLLYRPEAWYAEHGIDIRLSTSVTRVDRRASEVTLSDGSRLAYETL
FT                   AFATGATPRRLPASIGGDLAGVYVVRDFRDADRLAEEMKPGRRALVIGGGYIGLEAAAV
FT                   ARTCGLEVTVIEMADRILQRVASAATSAIVREIHRSHGVDIRERMGLHRLIGDNGPVTA
FT                   AELSDGSVIPVDVVIVGIGVGANDALAHDAGLETANGILVDGHGRTSDPAIFAIGDCAV
FT                   LPWQGMRIRLESVQNAVDQAEAVAAILAGGTAPYDPKPWFWSDQYDVKLQIAGFGLGHD
FT                   ETLVRPGQREGSVSVWYFRQGKLIAVDAINDAKAYVTGKKLLEAGVTPDPALLADPQVD
FT                   LKSLLA"
     gtgtcgggaa gacttgtcgt tatcggtggc ggccaggcgg cctttgctct cgttgccaag        60
     cttcgcgctt tgcaggacac ccgcccgatc accgtcatcg ccgccgaatc gagtcttccg       120
     tatcagcgcc cgcctctctc caagaaatac ctcttgcggg aaatgacgct cgatcgcctg       180
     ctctatcggc cggaggcctg gtatgcggag cacgggatcg acatccgcct ttcgaccagc       240
     gtcacgcggg tggaccgccg cgcaagcgag gtcacgctca gcgacggctc gcggcttgcc       300
     tacgagacat tggcttttgc gaccggcgcg acgccgcgtc gcctgccggc gtcaattggc       360
     ggcgatctgg cgggcgtcta tgtggtgcgc gacttcaggg atgccgaccg gcttgccgaa       420
     gagatgaagc ctggacggcg tgcgctggtg atcggcggcg gttatatcgg cctggaggcg       480
     gcggcggtgg cccgcacctg cgggctcgag gtcacggtga tcgagatggc cgaccgcatc       540
     ctgcagcgcg tggcttccgc cgcgacctcg gcgatcgtcc gggagatcca ccgctcgcat       600
     ggggtcgata tccgtgaacg catgggcctt caccggctga tcggcgataa cgggccggtg       660
     acggcggctg aactttccga cggctcggtc attccggtcg acgtggtgat cgtcggcatt       720
     ggcgtggggg cgaatgatgc cctggcgcat gatgcaggtc tcgaaaccgc caacggcatc       780
     ctcgtcgacg gccacggccg gacatccgat ccggcgatct ttgcgattgg cgattgcgcc       840
     gtcttgccct ggcagggcat gcgcatccgt ctcgaatcgg tccagaacgc cgtggaccag       900
     gcggaagcgg tcgcggccat cctcgccggc ggcaccgctc cctatgatcc gaagccctgg       960
     ttctggtcgg accagtatga cgtcaagctg cagattgccg gcttcgggct tggccatgac      1020
     gaaaccctgg tccgtccggg ccagcgcgag ggcagcgtgt cggtctggta tttccgccag      1080
     ggcaagctga tcgccgtcga cgccatcaac gacgcaaagg cctatgtgac cggcaagaag      1140
     ctgctcgaag ccggcgtgac ccccgatccc gccctcctgg ccgatccgca ggtcgatctc      1200
     aaatccttgc tggcgtag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page