(data stored in ACNUC7421 zone)

EMBL: CP001389.PE398

CP001389.PE398       Location/Qualifiers
FT   CDS_pept        452726..455512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04060"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24202"
FT                   /db_xref="GOA:C3MGT7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT7"
FT                   /protein_id="ACP24202.1"
FT                   /translation="MFKILSCLVVEHDLRLVALAAIICALSSYGAVTLLQRARLSRGGP
FT                   RAIWLGAAGIASGFGIWATHFIAMLAYDPGVVLGYHTSLTTLSLVVAILLTTTALAIAT
FT                   YAKGRPAWLLGGLVLGAGVGCMHFLGMAALELPGFIRWDRTLVVASVLAGVLFEMVAIF
FT                   AIKRDQSKAQLAATAAMTLGIVVLHFTAMGAVTMEVEFATGIQEGMIQPHFLAFVLAGT
FT                   AFFLLSAVLIAAGFARHAEILAVASEKEFSRFVGSVKDYAIYMLDVDGRVASWNAGAEA
FT                   NKGYTAEEIVGKNFACFYSPEDQAANLPARALRIALEAGQYETEGWRYRKDGTRFWAHV
FT                   VIDTIVGEDGGHAGFIKIAKDITKRKEDADRIAEVSKNLDIALENMTQGICLFDHADRL
FT                   LISNRRCLEIFELPESLAGFGLTFREVLDRMCARTYPDPAVAEAKSEAAYRKHRLEIAG
FT                   KGGGDFVEKLSNGRSILVKHRTLPDGGWVSTYEDITERLDSEEQISFLARHDSLTGLPN
FT                   RLQFNSHLDEELDAAVWFSRKVAVIGIDLDKFKEVNDLHGHAAGDFVLVTIAQRMKEHL
FT                   QEGEFVARFGGDEFAAVKRFEDLSEVHDFLRRIETCLQEEMRFGDFELKSGGSMGVAIY
FT                   PQDAETADTLINNADLAMYRAKAALNQTICFYEVSMDEAARGRRALANDLWEAVERSEL
FT                   ALHYQVQKSVTTGDVIGYEVLLRWNHPERGLVPPNEFIPLAEECGAILPIGEWVLRQAC
FT                   REAASWDAEYKIAVNLSPVQLANGDVVSLVHSILVETGLDAKRLELEITESTIIDDKER
FT                   ALLTLRAIKALGVTIAIDDFGTGYSSLETLRAFPFDKIKLDKSFMSEVEGSPQAKAIIR
FT                   AILALGHSLQVPVLAEGVETQKQLDILQAEGCDEAQGYLLGRPAPIGSVVGVRTEAA"
     atgttcaaga ttctctcgtg cctcgtggtg gaacacgatc tgcggctggt ggcactggca        60
     gcgatcattt gtgccttgtc gagctatggt gccgtgacgc tgcttcagcg cgcccgtctt       120
     tccagaggcg ggccccgggc gatctggctg ggagcagcgg ggatcgccag tggcttcggc       180
     atttgggcga cccatttcat cgccatgctc gcctatgacc ctggagtcgt gctcggttat       240
     cacacaagcc tcacgacctt gtcgctggtc gtcgcgatcc tgctgacgac gacggcgctg       300
     gcgatcgcca cttatgcgaa gggccgtccc gcatggttgc tgggtggttt ggtgctgggc       360
     gccggcgtgg gttgcatgca tttcctcgga atggccgcgc tcgaactgcc tggcttcatc       420
     cgttgggatc ggacgctggt cgtcgcgtcg gtcctcgccg gtgtgctctt cgagatggtt       480
     gcgatcttcg cgatcaagcg ggaccagtcg aaggctcagt tggccgccac agcggcgatg       540
     acgctcggca tcgttgtgct gcacttcacc gcgatgggcg cggtgacgat ggaagtggag       600
     ttcgcgaccg ggatccaaga gggcatgatc cagccgcatt ttctggcctt cgtgcttgcc       660
     ggaaccgcct tctttcttct gtccgccgtg ctgatcgcgg ccggctttgc gcgccacgcc       720
     gaaatcctcg ccgtggcctc ggagaaggaa ttttcccgct ttgtcggcag cgtcaaggac       780
     tatgccatct acatgctcga tgtcgacggc cgcgtggcga gttggaacgc cggggccgag       840
     gccaacaagg gttacacggc cgaggagatc gtcggcaaga acttcgcctg cttctattcg       900
     ccggaggatc aggcggcgaa cctgccggcg cgcgccttgc gcatcgccct tgaggccggg       960
     cagtacgaaa ccgagggttg gcggtaccga aaggatggta cccgcttctg ggcgcatgtc      1020
     gtcatcgaca cgatcgtcgg cgaggatggc ggccacgccg gcttcatcaa gattgccaag      1080
     gacatcacca agcgaaaaga ggatgccgac cggatcgccg aggtcagcaa gaatctcgac      1140
     attgctctcg aaaacatgac acagggcata tgcctgttcg atcatgccga ccgcctgctg      1200
     atctcgaacc gccgttgcct cgagatcttc gaattgccgg aatcgcttgc cggcttcgga      1260
     ctgacctttc gcgaagttct cgatcgcatg tgtgcccgca cctatccgga tccggccgtc      1320
     gcggaagcga agtcggaagc ggcctaccgc aagcacaggc tcgagattgc cgggaagggc      1380
     ggcggcgact ttgtcgagaa attgtcgaac ggacgctcga tcctcgtcaa gcatcgcacc      1440
     ctgcccgatg gcggctgggt ctcaacctac gaggacatca ccgagcggct cgactccgag      1500
     gagcagattt ccttcctcgc gcgtcatgac agcctgaccg ggctgcccaa ccgactgcag      1560
     ttcaacagcc acctcgacga agagctcgac gcggccgtct ggttctcgcg caaggtggcg      1620
     gtgatcggga tcgatctcga caagttcaag gaagtcaacg atctgcacgg tcatgccgcc      1680
     ggcgacttcg tgctggtgac gatcgcacag cggatgaagg aacatcttca agagggcgaa      1740
     ttcgtcgccc gcttcggggg agacgagttt gctgcagtga aacgtttcga ggacctctcc      1800
     gaggtccacg acttcctgcg gcggatcgag acgtgcctgc aggaggagat gcgcttcggt      1860
     gatttcgagc tgaaatccgg cggcagcatg ggtgtggcca tctacccgca ggacgcggag      1920
     accgccgaca ccttgatcaa caacgccgac ctcgcaatgt atcgcgcaaa ggcggcgctc      1980
     aaccagacga tctgcttcta cgaggtctcg atggacgagg ccgcccgcgg acgcagggcg      2040
     ctcgccaacg atctctggga ggcggtggag aggagcgagc tggccctgca ctaccaggtc      2100
     cagaaatccg tcacgacagg cgacgtgatc ggctatgaag tcctgttgcg ctggaaccat      2160
     ccggaacgcg gcctggtacc gccgaacgaa ttcattccgc tcgccgagga atgcggcgcc      2220
     atcctgccga tcggcgaatg ggtgctgcgc caggcttgcc gggaagcggc atcctgggat      2280
     gccgagtaca agatcgccgt aaacctgtcg ccggtgcagc tggcgaatgg cgacgtcgtc      2340
     agcctcgtcc actcgatcct cgtcgaaacc gggctcgacg cgaaaaggct cgagctcgag      2400
     attaccgagt cgacgatcat cgacgacaag gagcgagcgc tgttgacgct ccgcgcgatc      2460
     aaggcgctgg gcgtgacgat cgcaatcgac gatttcggca cgggttattc ctcgctcgaa      2520
     accttgcggg cgttcccctt cgacaagatc aagctcgaca agagcttcat gtcggaagtc      2580
     gaaggcagcc cgcaagcaaa ggcgatcatc cgcgccatcc tcgcgcttgg ccatagcctg      2640
     caagttccgg tgctcgccga aggggtcgag acgcagaagc agctcgacat tctgcaggcg      2700
     gaaggctgcg acgaggcgca gggctatctt ctcgggcgac cggcaccgat cggttcggtg      2760
     gtcggtgtca ggaccgaggc cgcctga                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page